Protein
MCA_04841_1
Length
56 amino acids
Browser: contigC:4224153-4224399+
RNA-seq: read pairs 17536, FPKM 3801.3, percentile rank 99.0% (100% = highest expression)
Protein function
KEGG: | K02980 | RP-S29e | small subunit ribosomal protein S29e |
---|---|---|---|
EGGNOG: | 0PRVZ | RPS29 | 40S ribosomal protein S29 |
SGD closest match: | S000004380 | RPS29A | 40S ribosomal protein S29-A |
CGD closest match: | CAL0000180472 | CAALFM_CR08480CA | Ribosomal 40S subunit protein S29A |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_04848_1 | 92.86% | 56 | 2e-34 | MIA_04848_1 |
A0A0F7RQS2_GEOCN | 91.07% | 56 | 9e-34 | Similar to Saccharomyces cerevisiae YLR388W RPS29A Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA02s08403g PE=4 SV=1 |
A0A060T1N7_BLAAD | 87.50% | 56 | 3e-32 | ARAD1C22066p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C22066g PE=4 SV=1 |
A0A1E3PEX9_9ASCO | 83.93% | 56 | 1e-31 | Ribosomal protein S14 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_19878 PE=4 SV=1 |
Q6CFB0_YARLI | 78.57% | 56 | 1e-29 | YALI0B08748p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B08748g PE=4 SV=2 |
UniRef50_A0A1G4KPI4 | 75.00% | 56 | 1e-24 | Small (40S) ribosomal subunit n=4 Tax=saccharomyceta TaxID=716545 RepID=A0A1G4KPI4_KOMPC |
RS29A_YEAST | 73.21% | 56 | 2e-27 | 40S ribosomal protein S29-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS29A PE=1 SV=3 |
A0A1D8PTR4_CANAL | 71.43% | 56 | 9e-27 | Ribosomal 40S subunit protein S29A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR08480CA PE=4 SV=1 |
A0A1E4TKB6_9ASCO | 66.67% | 54 | 6e-23 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30440 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1324
Predicted cleavage: 46
Protein family membership
- Ribosomal protein S14 (IPR001209)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF00253 (Ribosomal_S14)
-

Unintegrated signatures
Protein sequence
>MCA_04841_1 MAHENVWYSHPRTYGKGSRQCRITAGRNAVIRKYGLNICRQSFREKAADIGFHKYQ
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome