Protein
MIA_04844_1
Length
215 amino acids
Browser: contig06:1122487-1123135+
Protein function
| EGGNOG: | 0PGJA | TIM23 | mitochondrial import inner membrane translocase subunit tim23 |
|---|---|---|---|
| SGD closest match: | S000005300 | TIM23 | Mitochondrial import inner membrane translocase subunit TIM23 |
| CGD closest match: | CAL0000185762 | TIM23 | Mitochondrial import inner membrane translocase subunit TIM23 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_04837_1 | 72.811% | 217 | 7.59e-93 | MCA_04837_1 |
| A0A0J9XAF0_GEOCN | 66.514% | 218 | 6.13e-83 | Similar to Saccharomyces cerevisiae YNR017W TIM23 Essential component of the Translocase of the Inner Mitochondrial membrane (TIM23 complex) OS=Geotrichum candidum GN=BN980_GECA07s01572g PE=4 SV=1 |
| UniRef50_C4Y678 | 58.605% | 215 | 2.49e-63 | Mitochondrial import inner membrane translocase subunit TIM23 n=2 Tax=Saccharomycetales TaxID=4892 RepID=C4Y678_CLAL4 |
| A0A167C9C6_9ASCO | 62.564% | 195 | 7.88e-65 | Protein transporter TIM23 OS=Sugiyamaella lignohabitans GN=TIM23 PE=4 SV=1 |
| A0A1E3PP53_9ASCO | 55.399% | 213 | 3.84e-63 | Mitochondrial import inner membrane translocase subunit TIM23 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45377 PE=3 SV=1 |
| A0A060T6X2_BLAAD | 58.904% | 219 | 5.63e-61 | ARAD1C23980p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C23980g PE=4 SV=1 |
| Q59YG5_CANAL | 52.558% | 215 | 2.43e-59 | Mitochondrial import inner membrane translocase subunit TIM23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM23 PE=3 SV=1 |
| TIM23_YEAST | 49.107% | 224 | 5.74e-57 | Mitochondrial import inner membrane translocase subunit TIM23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM23 PE=1 SV=1 |
| A0A1E4TFU3_9ASCO | 61.236% | 178 | 7.69e-56 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_57054 PE=4 SV=1 |
| Q6C003_YARLI | 48.611% | 216 | 6.32e-45 | YALI0F29183p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F29183g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0183
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF02466 (Tim17)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MIA_04844_1 MGWFFGNNKNNNNETSVEASSIEPAKPEYSLGFDPSTVNVSSILSTPIDSTKLHPLAGLDRGLEYLNIEDDALSSLPGSQ GIIPIKGWTDDLCYGTGTVYLLGLGVGGAFGLIEGLRKTPADASFKLRLNGILNAVTRRGPFLGNSAGVLTLIYNLINAS LDKLRGKHDDWNSLASGAIAGAMFKCTKGPKPMLIASGLMTAAAGAWCALKRAIF
GO term prediction
Biological Process
GO:0006886 intracellular protein transport
Molecular Function
GO:0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity
Cellular Component
GO:0005744 mitochondrial inner membrane presequence translocase complex