Protein
MCA_04837_1
Length
217 amino acids
Gene name: TIM23
Description: Mitochondrial import inner membrane translocase subunit TIM23
Browser: contigC:4214907-4215561+
RNA-seq: read pairs 2045, FPKM 115.9, percentile rank 81.2% (100% = highest expression)
Protein function
Annotation: | TIM23 | Mitochondrial import inner membrane translocase subunit TIM23 | |
---|---|---|---|
KEGG: | K17794 | TIM23 | mitochondrial import inner membrane translocase subunit TIM23 |
EGGNOG: | 0PGJA | TIM23 | mitochondrial import inner membrane translocase subunit tim23 |
SGD closest match: | S000005300 | TIM23 | Mitochondrial import inner membrane translocase subunit TIM23 |
CGD closest match: | CAL0000185762 | TIM23 | Mitochondrial import inner membrane translocase subunit TIM23 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_04844_1 | 72.81% | 217 | 2e-95 | MIA_04844_1 |
A0A0J9XAF0_GEOCN | 68.66% | 217 | 2e-92 | Similar to Saccharomyces cerevisiae YNR017W TIM23 Essential component of the Translocase of the Inner Mitochondrial membrane (TIM23 complex) OS=Geotrichum candidum GN=BN980_GECA07s01572g PE=4 SV=1 |
A0A060T6X2_BLAAD | 60.27% | 219 | 6e-70 | ARAD1C23980p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C23980g PE=4 SV=1 |
A0A167C9C6_9ASCO | 56.22% | 217 | 3e-69 | Protein transporter TIM23 OS=Sugiyamaella lignohabitans GN=TIM23 PE=4 SV=1 |
UniRef50_C4Y678 | 57.27% | 220 | 4e-65 | Mitochondrial import inner membrane translocase subunit TIM23 n=2 Tax=Saccharomycetales TaxID=4892 RepID=C4Y678_CLAL4 |
A0A1E3PP53_9ASCO | 56.02% | 216 | 2e-67 | Mitochondrial import inner membrane translocase subunit TIM23 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45377 PE=3 SV=1 |
Q59YG5_CANAL | 53.92% | 217 | 9e-64 | Mitochondrial import inner membrane translocase subunit TIM23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM23 PE=3 SV=1 |
A0A1E4TFU3_9ASCO | 51.60% | 219 | 9e-59 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_57054 PE=4 SV=1 |
TIM23_YEAST | 47.96% | 221 | 3e-53 | Mitochondrial import inner membrane translocase subunit TIM23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM23 PE=1 SV=1 |
Q6C003_YARLI | 45.74% | 223 | 3e-42 | YALI0F29183p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F29183g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0157
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF02466 (Tim17)
-

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_04837_1 MSWIFGGNKTTQQQDQTQQQQVEPPKSELSLGFDPTSIQDVSSFLSTAPIDAAQLHPLAGLDKGLEYLNIEDEALSTKPG STGILPIKGWTDDLCYGTGTVYLMGLGLGGMYGFAEGLRKTPADASFKLRLNGILNAVTRRGPFLGNSAGVLTLLYNLIN ASIGEYRGVYDDYNSLASGALAGAVYKCSKGPKPMLIASAIMTGVAGAWCGLKRVIF
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.