Protein

MIA_04834_1

Length
351 amino acids

Browser: contig06:1096772-1097828-

Protein function

EGGNOG:0PGJWFG07186.160s ribosomal protein
SGD closest match:S000002419RPL4B60S ribosomal protein L4-B
CGD closest match:CAL0000176632RPL4BRibosomal 60S subunit protein L4B

Protein alignments

%idAln lengthE-value
MCA_05038_188.000%3500.0MCA_05038_1
A0A0J9XAV2_GEOCN71.667%3605.85e-164Similar to Saccharomyces cerevisiae YBR031W RPL4A N-terminally acetylated protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA08s01869g PE=4 SV=1
A0A1E3PCF2_9ASCO70.950%3581.64e-163Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84587 PE=4 SV=1
A0A060T1U7_BLAAD74.545%3301.34e-159ARAD1C23804p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C23804g PE=4 SV=1
Q6CCT0_YARLI75.529%3318.63e-159YALI0C06820p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C06820g PE=4 SV=1
A0A167FFE1_9ASCO71.884%3455.47e-155Ribosomal 60S subunit protein L4A OS=Sugiyamaella lignohabitans GN=RPL4A PE=4 SV=1
A0A1D8PFV1_CANAL67.429%3502.96e-149Ribosomal 60S subunit protein L4B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL4B PE=4 SV=1
UniRef50_A0A1D8PFV167.429%3507.19e-146Ribosomal 60S subunit protein L4B n=17 Tax=saccharomyceta TaxID=716545 RepID=A0A1D8PFV1_CANAL
RL4B_YEAST66.482%3616.11e-13660S ribosomal protein L4-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL4B PE=1 SV=2
A0A1E4TBY9_9ASCO64.759%3322.85e-136Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_134368 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2571

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 351

Detailed signature matches

  1. Family IPR002136
    Ribosomal protein L4/L1e
    1. PF00573 (Ribosomal_L4)
  2. Domain IPR023574
    Ribosomal protein L4 domain
    1. G3DSA:3.40.13...
    2. SSF52166 (Ribosomal...)
  3. Domain IPR025755
    60S ribosomal protein L4, C-terminal domain
    1. PF14374 (Ribos_L4_a...)
  4. SITE IPR013000
    Ribosomal protein L4/L1e, eukaryotic/archaeal, conserved site
    1. PS00939 (RIBOSOMAL_L1E)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_04834_1
MSARPQITVHSLSGETLSSNVVVPAVFKAPIRTDIVHSVWTGVAKNKRQAYAVASNAGEQTSAESWGTGRAVARIPRVGG
GGTHRSGQAAFGNMCRGGRLFAPTKVWRKWHVKVNQNQKRYATASAIAATAVAPLVLARGHRAEKIPEVPLVVSSELETL
TKTKDAVAALKAVGAGADVARVIKSKTLRAGQGKLRGRRFTQRKGPLVVYAEDKGLVKAFKNIPGVETANVKSLSLLQLA
PGSHLGRFVIWTESAIALLDDIWASKSGFSLPQGLISNSDLKSILESSEIQAALRPANKNKQEKAPQKKNPLKNKEALLK
LNPYAGVKKASKVEKKDVATSKVLVDILNQE

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome