Protein
MIA_04817_1
Length
308 amino acids
Browser: contig06:1063595-1064522-
Protein function
EGGNOG: | 0PH4D | CFD1 | Component of the cytosolic iron-sulfur (Fe S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NBP35-CFD1 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins |
---|---|---|---|
SGD closest match: | S000001265 | CFD1 | Cytosolic Fe-S cluster assembly factor CFD1 |
CGD closest match: | CAL0000176016 | CFD1 | Cytosolic Fe-S cluster assembly factor CFD1 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XFS0_GEOCN | 76.491% | 285 | 4.11e-149 | Cytosolic Fe-S cluster assembly factor CFD1 OS=Geotrichum candidum GN=CFD1 PE=3 SV=1 |
MCA_05134_1 | 65.569% | 334 | 1.03e-135 | MCA_05134_1 |
A0A060TBI4_BLAAD | 71.174% | 281 | 2.58e-131 | Cytosolic Fe-S cluster assembly factor CFD1 OS=Blastobotrys adeninivorans GN=CFD1 PE=3 SV=1 |
A0A170QZV9_9ASCO | 71.378% | 283 | 9.63e-130 | Cytosolic Fe-S cluster assembly factor CFD1 OS=Sugiyamaella lignohabitans GN=CFD1 PE=3 SV=1 |
A0A1E3PGJ7_9ASCO | 69.611% | 283 | 5.86e-129 | Cytosolic Fe-S cluster assembly factor CFD1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=CFD1 PE=3 SV=1 |
CFD1_YARLI | 71.849% | 238 | 6.60e-115 | Cytosolic Fe-S cluster assembly factor CFD1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CFD1 PE=3 SV=1 |
CFD1_YEAST | 61.071% | 280 | 6.70e-114 | Cytosolic Fe-S cluster assembly factor CFD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CFD1 PE=1 SV=1 |
UniRef50_P40558 | 61.071% | 280 | 1.60e-110 | Cytosolic Fe-S cluster assembly factor CFD1 n=261 Tax=cellular organisms TaxID=131567 RepID=CFD1_YEAST |
CFD1_CANAL | 61.379% | 290 | 1.45e-113 | Cytosolic Fe-S cluster assembly factor CFD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CFD1 PE=3 SV=1 |
A0A1E4TIV1_9ASCO | 63.509% | 285 | 1.52e-111 | Cytosolic Fe-S cluster assembly factor CFD1 OS=Tortispora caseinolytica NRRL Y-17796 GN=CFD1 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0549
Protein family membership
Domains and repeats
-
Domain
1
50
100
150
200
250
308
Detailed signature matches

Unintegrated signatures
-
-
cd01983 (Fer4_NifH)
Residue annotation
-
Walker A motif cd0...
Protein sequence
>MIA_04817_1 MNAIPDDLPSLKSVKHIILVLSGKGGVGKSSVTTQLALTLVAKNYKVGVLDIDLTGPSAPRMFGLEGRQVHQSVAGWVPV YAQPPSAGSGSLAVMSLGFLLQQRGDAVVWRGPKKTAMIRQLLTDMVWGDLDYLLIDTPPGTSDEHISVAEALKNAANPD GAVLVTTPQGIATADVRKELSFCRKVGFNVLGVVENMSGYVCPHCSECSNIFSSGGGLKLAQQFNLPFLGSVPIDPQFVL MIESQKSNKIGKDDEPHSHADEPSLVQKYKDTSALYPIFSTIVDKLVQQIKNDDTDALDISQVDINKP
GO term prediction
Biological Process
GO:0016226 iron-sulfur cluster assembly
Molecular Function
GO:0005524 ATP binding
GO:0051539 4 iron, 4 sulfur cluster binding
Cellular Component
None predicted.