Protein

MIA_04755_1

Length
326 amino acids


Browser: contig06:905544-906739+

Protein function

EGGNOG:0PN3PSWC5Component of the SWR1 complex which mediates the ATP- dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Involved in chromosome stability
SGD closest match:S000000435SWC5SWR1-complex protein 5
CGD closest match:CAL0000185200SWC5SWR1-complex protein 5

Protein alignments

%idAln lengthE-value
MCA_05103_140.346%3472.96e-57MCA_05103_1
A0A0J9X7I3_GEOCN41.720%3143.06e-48SWR1-complex protein 5 OS=Geotrichum candidum GN=BN980_GECA04s05576g PE=3 SV=1
UniRef50_A0A0J9X7I341.720%3146.25e-45SWR1-complex protein 5 n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X7I3_GEOCN
A0A167FDQ6_9ASCO34.727%3111.81e-36Swc5p OS=Sugiyamaella lignohabitans GN=SWC5 PE=4 SV=1
A0A060T124_BLAAD38.934%2441.17e-33SWR1-complex protein 5 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C13200g PE=3 SV=1
SWC5_YEAST34.959%2461.34e-24SWR1-complex protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWC5 PE=1 SV=1
A0A1E3PLL5_9ASCO34.764%2331.92e-22SWR1-complex protein 5 (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82183 PE=3 SV=1
SWC5_YARLI60.377%535.39e-14SWR1-complex protein 5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWC5 PE=3 SV=1
SWC5_CANAL34.899%1492.80e-13SWR1-complex protein 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWC5 PE=3 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0073

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 326

Detailed signature matches

    1. PF07572 (BCNT)
    2. PS51279 (BCNT_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_04755_1
MSMDTKISTKPDDIDQHQLEDDNYRESEDEDYKDENEVNYESETDDSSDDELPKEDNKKKVSKQPITSTPSEAVDYEKYS
NIQGEGLIKTRAQREAEKLKQKEFENAAKVNSDFDVNSVWESLKSEAQSAPASRRSSTPAKSVSPDALLTNDSSYKLTTG
TSTLTTATVTSNTASSGLSDEYIVIKRVYSFAGKVTQEDVRVHRSSAEAIAYLKQQEDNNSKKSPVDEDNSVTSAAQGRR
KSSVSKRRGPVKRKQGSLLEELNSLRPKKLNTLEKSKMDWLGYVDNAGIKDELTLHNKDGYLQKQDFLSRVDSRLDREIR
SNTRSK

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.