Protein
MIA_04752_1
Length
85 amino acids
Browser: contig06:898657-898994-
Protein function
| EGGNOG: | 0PS16 | Mitochondrial ATP synthase epsilon chain domain-containing protein | |
|---|---|---|---|
| CGD closest match: | CAL0000195314 | orf19.5597.1 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05099_1 | 76.000% | 50 | 7.25e-23 | MCA_05099_1 |
| UniRef50_A0A179HE98 | 75.000% | 44 | 2.05e-13 | Mitochondrial ATP synthase epsilon chain domain-containing protein n=7 Tax=leotiomyceta TaxID=716546 RepID=A0A179HE98_9HYPO |
| A0A0J9XHS7_GEOCN | 58.000% | 50 | 4.35e-16 | Similar to Saccharomyces cerevisiae YPL271W ATP15 Epsilon subunit of the F1 sector of mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA15s02155g PE=4 SV=1 |
| A0A1E3PUC9_9ASCO | 59.091% | 44 | 2.71e-12 | Mitochondrial ATP synthase epsilon chain domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49199 PE=4 SV=1 |
| A0A060T0H1_BLAAD | 45.833% | 48 | 1.41e-09 | ARAD1C13277p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C13277g PE=4 SV=1 |
| A0A1D8PQ38_CANAL | 43.137% | 51 | 1.09e-08 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5597.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9720
Predicted cleavage: 45
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
Residue annotation
-
delta subunit inte...
-
gamma subunit inte...
Protein sequence
>MIA_04752_1 MSAAKVSYVSALSRGAVCRAPRLQLRRPFPVRYNRYLAIAARTVRNALKEDKRIAAERRNLLETRSAKWENGKQEEYAPI KFLTK
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Cellular Component
GO:0000275 mitochondrial proton-transporting ATP synthase complex, catalytic core F(1)