Protein

MCA_05099_1

Length
67 amino acids


Description: Putative ATP synthase subunit, mitochondrial

Browser: contigD:355576-356207-

RNA-seq: read pairs 14706, FPKM 2672.2, percentile rank 98.2% (100% = highest expression)

Protein function

Annotation:Putative ATP synthase subunit, mitochondrial
KEGG:K02135ATPeF1E F-type H+-transporting ATPase subunit epsilon
EGGNOG:0PS16Mitochondrial ATP synthase epsilon chain domain-containing protein
SGD closest match:S000006192ATP15ATP synthase subunit epsilon, mitochondrial
CGD closest match:CAL0000195314orf19.5597.1Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_04752_176.00%506e-22MIA_04752_1
UniRef50_B6H9L955.38%652e-17Pc16g11100 protein n=118 Tax=Fungi TaxID=4751 RepID=B6H9L9_PENRW
A0A0J9XHS7_GEOCN57.63%597e-18Similar to Saccharomyces cerevisiae YPL271W ATP15 Epsilon subunit of the F1 sector of mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA15s02155g PE=4 SV=1
A0A1E3PUC9_9ASCO53.45%581e-15Mitochondrial ATP synthase epsilon chain domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49199 PE=4 SV=1
A0A060T0H1_BLAAD49.15%593e-13ARAD1C13277p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C13277g PE=4 SV=1
A0A1D8PQ38_CANAL39.66%589e-09Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5597.1 PE=4 SV=1
ATP5E_YEAST33.90%591e-06ATP synthase subunit epsilon, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP15 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9229
Predicted cleavage: 24

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF04627 (ATP-synt_Eps)
    2. cd12153 (F1-ATPase_...)
    3. SSF48690 (Epsilon s...)

Residue annotation

  1. gamma subunit inte...
  2. delta subunit inte...

Protein sequence

>MCA_05099_1
MSVSWKKAGFTYNRYLAIAARTVRNALKEEKRVANSGRSNLETRFAKWENGKQEDYTPVSFTNSKTA

GO term prediction

Biological Process

GO:0015986 ATP synthesis coupled proton transport

Molecular Function

GO:0046933 proton-transporting ATP synthase activity, rotational mechanism

Cellular Component

GO:0000275 mitochondrial proton-transporting ATP synthase complex, catalytic core F(1)