Protein

MIA_04699_1

Length
160 amino acids

Browser: contig06:753489-754029-

Protein function

SGD closest match:S000001539TMA19Translationally-controlled tumor protein homolog
CGD closest match:CAL0000181023TMA19Translationally-controlled tumor protein homolog

Protein alignments

%idAln lengthE-value
UniRef50_W7MPV728.485%1651.08e-08Translationally-controlled tumor protein n=22 Tax=Dikarya TaxID=451864 RepID=W7MPV7_GIBM7
A0A1E4TGE4_9ASCO24.551%1675.20e-11Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_111455 PE=3 SV=1
A0A0J9X532_GEOCN24.260%1697.28e-10Similar to Saccharomyces cerevisiae YKL056C TMA19 Protein that associates with ribosomes OS=Geotrichum candidum GN=BN980_GECA03s03563g PE=3 SV=1
A0A060T6K5_BLAAD24.277%1731.96e-09ARAD1C14784p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C14784g PE=3 SV=1
TCTP_YEAST23.392%1715.33e-09Translationally-controlled tumor protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMA19 PE=1 SV=1
MCA_03122_123.494%1662.62e-08MCA_03122_1
TCTP_YARLI36.145%832.94e-08Translationally-controlled tumor protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E27071g PE=3 SV=1
A0A1E3PEW7_9ASCO26.543%1624.47e-08Translationally controlled tumor-associated OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47716 PE=3 SV=1
TCTP_CANAL25.294%1707.94e-08Translationally-controlled tumor protein homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TMA19 PE=3 SV=1
A0A167D9E7_9ASCO27.711%831.12e-07Tma19p OS=Sugiyamaella lignohabitans GN=TMA19 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3042

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 160

Detailed signature matches

  1. Family IPR018105
    Translationally controlled tumour protein
    1. PF00838 (TCTP)
  2. Domain IPR011057
    Mss4-like
    1. SSF51316 (Mss4-like)
  3. Domain IPR034737
    Translationally controlled tumor protein (TCTP) domain
    1. PS51797 (TCTP_3)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:2.170.1...

Protein sequence

>MIA_04699_1
MNIYTDRLTGDKIFSDNHKINDVNDYIYEVDINEPSENYNNDEYKDLSKDELYSSLYEDYIGEFELSPIPDLGGGYFPLV
EEYLEELQKQGYENGEKIGASNIKVMSYISEVLSQNDEFDFLISPSYKSGGMIFPCGIREDGITRYIIIFKHGIVKEVAE

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.