Protein

MCA_03122_1

Length
168 amino acids


Browser: contigB:3430911-3431479-

RNA-seq: read pairs 23201, FPKM 1696.3, percentile rank 97.6% (100% = highest expression)

Protein function

EGGNOG:0PJSQtumor protein
SGD closest match:S000001539TMA19Translationally-controlled tumor protein homolog
CGD closest match:CAL0000181023TMA19Translationally-controlled tumor protein homolog

Protein alignments

%idAln lengthE-value
A0A0J9X532_GEOCN79.88%1699e-78Similar to Saccharomyces cerevisiae YKL056C TMA19 Protein that associates with ribosomes OS=Geotrichum candidum GN=BN980_GECA03s03563g PE=3 SV=1
A0A1E3PEW7_9ASCO71.43%1687e-72Translationally controlled tumor-associated OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47716 PE=3 SV=1
TCTP_YARLI70.83%1681e-71Translationally-controlled tumor protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E27071g PE=3 SV=1
A0A167D9E7_9ASCO70.83%1686e-69Tma19p OS=Sugiyamaella lignohabitans GN=TMA19 PE=3 SV=1
UniRef50_A0A1X6MV3766.67%1682e-64Uncharacterized protein n=2 Tax=Fungi TaxID=4751 RepID=A0A1X6MV37_9APHY
A0A060T6K5_BLAAD67.06%1706e-67ARAD1C14784p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C14784g PE=3 SV=1
TCTP_YEAST66.07%1684e-65Translationally-controlled tumor protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMA19 PE=1 SV=1
A0A1E4TGE4_9ASCO64.29%1688e-65Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_111455 PE=3 SV=1
TCTP_CANAL67.26%1682e-64Translationally-controlled tumor protein homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TMA19 PE=3 SV=1
MIA_01333_152.63%1713e-44MIA_01333_1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0524

Protein family membership

Domains and repeats

1 20 40 60 80 100 120 140 168

Detailed signature matches

    1. PR01653 (TCTPROTEIN)
    2. PF00838 (TCTP)
    1. SSF51316 (Mss4-like)
    1. PS51797 (TCTP_3)
    1. PS01003 (TCTP_2)
    2. PS01002 (TCTP_1)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_03122_1
MIIYSDIITNDELCSDAYDITEVDDVVYEVNSAMITIKPGADVDIGANPSAEEGEEALEEGTETVNNVVYSFRLQSTSFD
KKSYLTYLKGYMKNVKAKLMEKDPEAAAKFEAGAQAYAKKIVKNFKDFEFYTGESMDPDGMVVLLNWREDGTTPYLVFWK
HGLKEEKV

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.