Protein
MCA_03122_1
Length
168 amino acids
Browser: contigB:3430911-3431479-
RNA-seq: read pairs 23201, FPKM 1696.3, percentile rank 97.6% (100% = highest expression)
Protein function
| EGGNOG: | 0PJSQ | tumor protein | |
|---|---|---|---|
| SGD closest match: | S000001539 | TMA19 | Translationally-controlled tumor protein homolog |
| CGD closest match: | CAL0000181023 | TMA19 | Translationally-controlled tumor protein homolog |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9X532_GEOCN | 79.88% | 169 | 9e-78 | Similar to Saccharomyces cerevisiae YKL056C TMA19 Protein that associates with ribosomes OS=Geotrichum candidum GN=BN980_GECA03s03563g PE=3 SV=1 |
| A0A1E3PEW7_9ASCO | 71.43% | 168 | 7e-72 | Translationally controlled tumor-associated OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47716 PE=3 SV=1 |
| TCTP_YARLI | 70.83% | 168 | 1e-71 | Translationally-controlled tumor protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E27071g PE=3 SV=1 |
| A0A167D9E7_9ASCO | 70.83% | 168 | 6e-69 | Tma19p OS=Sugiyamaella lignohabitans GN=TMA19 PE=3 SV=1 |
| UniRef50_A0A1X6MV37 | 66.67% | 168 | 2e-64 | Uncharacterized protein n=2 Tax=Fungi TaxID=4751 RepID=A0A1X6MV37_9APHY |
| A0A060T6K5_BLAAD | 67.06% | 170 | 6e-67 | ARAD1C14784p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C14784g PE=3 SV=1 |
| TCTP_YEAST | 66.07% | 168 | 4e-65 | Translationally-controlled tumor protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMA19 PE=1 SV=1 |
| A0A1E4TGE4_9ASCO | 64.29% | 168 | 8e-65 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_111455 PE=3 SV=1 |
| TCTP_CANAL | 67.26% | 168 | 2e-64 | Translationally-controlled tumor protein homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TMA19 PE=3 SV=1 |
| MIA_01333_1 | 52.63% | 171 | 3e-44 | MIA_01333_1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0524
Protein family membership
- Translationally controlled tumour protein (IPR018105)
Domains and repeats
-
Domain
1
20
40
60
80
100
120
140
168
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MCA_03122_1 MIIYSDIITNDELCSDAYDITEVDDVVYEVNSAMITIKPGADVDIGANPSAEEGEEALEEGTETVNNVVYSFRLQSTSFD KKSYLTYLKGYMKNVKAKLMEKDPEAAAKFEAGAQAYAKKIVKNFKDFEFYTGESMDPDGMVVLLNWREDGTTPYLVFWK HGLKEEKV
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.