Protein

MIA_04692_1

Length
48 amino acids


Browser: contig06:740179-740406-

Protein alignments

%idAln lengthE-value
MCA_06024_179.167%482.11e-23MCA_06024_1
A0A0J9X9F2_GEOCN58.333%482.80e-14Similar to Saccharomyces cerevisiae YOR045W TOM6 Component of the TOM (Translocase of outer membrane) complex responsible for recognition and initial import steps for all directed proteins OS=Geotrichum candidum GN=BN980_GECA06s04547g PE=4 SV=1
UniRef50_A0A0J9X9F258.333%485.73e-11Similar to Saccharomyces cerevisiae YOR045W TOM6 Component of the TOM (Translocase of outer membrane) complex responsible for recognition and initial import steps for all directed proteins n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X9F2_GEOCN
A0A1E3PJR8_9ASCO42.000%503.50e-06Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46323 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0026

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_04692_1
MPAQEPSISDALAALVAESAPSILKTIGLFIAGVAFIKSSLMDNMTPQ

GO term prediction

Biological Process

GO:0030150 protein import into mitochondrial matrix

Molecular Function

None predicted.

Cellular Component

GO:0005742 mitochondrial outer membrane translocase complex