Protein

MIA_04692_1

Length
48 amino acids

Browser: contig06:740179-740406-

Protein alignments

%idAln lengthE-value
MCA_06024_179.167%482.11e-23MCA_06024_1
A0A0J9X9F2_GEOCN58.333%482.80e-14Similar to Saccharomyces cerevisiae YOR045W TOM6 Component of the TOM (Translocase of outer membrane) complex responsible for recognition and initial import steps for all directed proteins OS=Geotrichum candidum GN=BN980_GECA06s04547g PE=4 SV=1
UniRef50_A0A0J9X9F258.333%485.73e-11Similar to Saccharomyces cerevisiae YOR045W TOM6 Component of the TOM (Translocase of outer membrane) complex responsible for recognition and initial import steps for all directed proteins n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X9F2_GEOCN
A0A1E3PJR8_9ASCO42.000%503.50e-06Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46323 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0026

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR020266
    Mitochondrial import receptor subunit Tom6
    1. PF17112 (Tom6)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. TMhelix
  4. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_04692_1
MPAQEPSISDALAALVAESAPSILKTIGLFIAGVAFIKSSLMDNMTPQ

GO term prediction

Biological Process

GO:0030150 protein import into mitochondrial matrix

Molecular Function

None predicted.

Cellular Component

GO:0005742 mitochondrial outer membrane translocase complex