Protein
MIA_04692_1
Length
48 amino acids
Browser: contig06:740179-740406-
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_06024_1 | 79.167% | 48 | 2.11e-23 | MCA_06024_1 |
A0A0J9X9F2_GEOCN | 58.333% | 48 | 2.80e-14 | Similar to Saccharomyces cerevisiae YOR045W TOM6 Component of the TOM (Translocase of outer membrane) complex responsible for recognition and initial import steps for all directed proteins OS=Geotrichum candidum GN=BN980_GECA06s04547g PE=4 SV=1 |
UniRef50_A0A0J9X9F2 | 58.333% | 48 | 5.73e-11 | Similar to Saccharomyces cerevisiae YOR045W TOM6 Component of the TOM (Translocase of outer membrane) complex responsible for recognition and initial import steps for all directed proteins n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X9F2_GEOCN |
A0A1E3PJR8_9ASCO | 42.000% | 50 | 3.50e-06 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46323 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0026
Protein family membership
- Mitochondrial import receptor subunit Tom6 (IPR020266)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_04692_1 MPAQEPSISDALAALVAESAPSILKTIGLFIAGVAFIKSSLMDNMTPQ
GO term prediction
Biological Process
GO:0030150 protein import into mitochondrial matrix
Molecular Function
None predicted.
Cellular Component
GO:0005742 mitochondrial outer membrane translocase complex