Protein
MCA_06024_1
Length
54 amino acids
Browser: contigD:3058528-3059011+
RNA-seq: read pairs 3768, FPKM 846.5, percentile rank 96.2% (100% = highest expression)
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04692_1 | 79.17% | 48 | 3e-22 | MIA_04692_1 |
| A0A0J9X9F2_GEOCN | 59.18% | 49 | 2e-13 | Similar to Saccharomyces cerevisiae YOR045W TOM6 Component of the TOM (Translocase of outer membrane) complex responsible for recognition and initial import steps for all directed proteins OS=Geotrichum candidum GN=BN980_GECA06s04547g PE=4 SV=1 |
| UniRef50_A0A0J9X9F2 | 59.18% | 49 | 4e-10 | Similar to Saccharomyces cerevisiae YOR045W TOM6 Component of the TOM (Translocase of outer membrane) complex responsible for recognition and initial import steps for all directed proteins n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X9F2_GEOCN |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0013
Protein family membership
- Mitochondrial import receptor subunit Tom6 (IPR020266)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_06024_1 MSPQEPSIADAIAVLVAESAPTILKTVGLFVAGVVFIKSSLMDNMTPHLRLEQN
GO term prediction
Biological Process
GO:0030150 protein import into mitochondrial matrix
Molecular Function
None predicted.
Cellular Component
GO:0005742 mitochondrial outer membrane translocase complex