Protein
MIA_04685_1
Length
120 amino acids
Browser: contig06:727024-727387+
Protein function
EGGNOG: | 0PQ6S | RPS26 | 40s ribosomal protein |
---|---|---|---|
SGD closest match: | S000000933 | RPS26B | 40S ribosomal protein S26-B |
CGD closest match: | CAL0000180001 | RPS26A | 40S ribosomal protein S26 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_01326_1 | 95.798% | 119 | 1.48e-69 | MCA_01326_1 |
A0A0F7RT58_GEOCN | 91.667% | 120 | 2.76e-67 | 40S ribosomal protein S26 OS=Geotrichum candidum GN=BN980_GECA08s04157g PE=3 SV=1 |
A0A167FBI6_9ASCO | 83.333% | 120 | 7.37e-63 | 40S ribosomal protein S26 OS=Sugiyamaella lignohabitans GN=RPS26B PE=3 SV=1 |
UniRef50_A0A167FBI6 | 83.333% | 120 | 2.02e-59 | 40S ribosomal protein S26 n=9 Tax=Dikarya TaxID=451864 RepID=A0A167FBI6_9ASCO |
Q6C5A4_YARLI | 84.034% | 119 | 1.19e-61 | 40S ribosomal protein S26 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E19701g PE=3 SV=1 |
A0A1E4TE57_9ASCO | 82.906% | 117 | 1.58e-58 | 40S ribosomal protein S26 (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_15422 PE=3 SV=1 |
A0A1E3PNZ3_9ASCO | 73.333% | 120 | 1.36e-52 | 40S ribosomal protein S26 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_40138 PE=3 SV=1 |
Q5ALV6_CANAL | 70.940% | 117 | 1.46e-48 | 40S ribosomal protein S26 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS26A PE=3 SV=1 |
RS26B_YEAST | 66.667% | 117 | 2.97e-46 | 40S ribosomal protein S26-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS26B PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3990
Predicted cleavage: 30
Protein family membership
- Ribosomal protein S26e (IPR000892)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_04685_1 MPKKRANNGRSKKGRGHVSSIRCSNCARMVPKDKAIKRYLIRNMVEAAAIRDISEQSVYTEYVLPKLYLKIHYCVSCAIH SKVVRVRSREGRRIRTPPPRVRYNKDGKKINPTVASKAVY
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome