Protein
MCA_01326_1
Length
120 amino acids
Browser: contigA:4160723-4161086+
RNA-seq: read pairs 53576, FPKM 5471.0, percentile rank 99.7% (100% = highest expression)
Protein function
KEGG: | K02976 | RP-S26e | small subunit ribosomal protein S26e |
---|---|---|---|
EGGNOG: | 0PQ6S | RPS26 | 40s ribosomal protein |
SGD closest match: | S000000933 | RPS26B | 40S ribosomal protein S26-B |
CGD closest match: | CAL0000180001 | RPS26A | 40S ribosomal protein S26 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_04685_1 | 95.80% | 119 | 7e-62 | MIA_04685_1 |
A0A0F7RT58_GEOCN | 92.37% | 118 | 2e-59 | 40S ribosomal protein S26 OS=Geotrichum candidum GN=BN980_GECA08s04157g PE=3 SV=1 |
Q6C5A4_YARLI | 82.50% | 120 | 2e-55 | 40S ribosomal protein S26 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E19701g PE=3 SV=1 |
A0A167FBI6_9ASCO | 83.05% | 118 | 7e-55 | 40S ribosomal protein S26 OS=Sugiyamaella lignohabitans GN=RPS26B PE=3 SV=1 |
UniRef50_A0A167FBI6 | 83.05% | 118 | 2e-51 | 40S ribosomal protein S26 n=9 Tax=Dikarya TaxID=451864 RepID=A0A167FBI6_9ASCO |
A0A1E4TE57_9ASCO | 83.76% | 117 | 6e-53 | 40S ribosomal protein S26 (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_15422 PE=3 SV=1 |
A0A1E3PNZ3_9ASCO | 77.68% | 112 | 7e-48 | 40S ribosomal protein S26 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_40138 PE=3 SV=1 |
Q5ALV6_CANAL | 70.09% | 117 | 4e-43 | 40S ribosomal protein S26 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS26A PE=3 SV=1 |
RS26B_YEAST | 65.83% | 120 | 2e-42 | 40S ribosomal protein S26-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS26B PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.4379
Predicted cleavage: 30
Protein family membership
- Ribosomal protein S26e (IPR000892)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_01326_1 MPKKRANNGRSKKGRGHVSSIRCSNCARMVPKDKAIKRYMIRNMVEAAAIRDISEASVYKEYVLPKLYLKIHYCISCAIH SKVVRVRSREGRRIRSPPPRVRYNKDGKKINPTVASKAVL
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome