Protein

MCA_01326_1

Length
120 amino acids

Browser: contigA:4160723-4161086+

RNA-seq: read pairs 53576, FPKM 5471.0, percentile rank 99.7% (100% = highest expression)

Protein function

KEGG:K02976RP-S26e small subunit ribosomal protein S26e
EGGNOG:0PQ6SRPS2640s ribosomal protein
SGD closest match:S000000933RPS26B40S ribosomal protein S26-B
CGD closest match:CAL0000180001RPS26A40S ribosomal protein S26

Protein alignments

%idAln lengthE-value
MIA_04685_195.80%1197e-62MIA_04685_1
A0A0F7RT58_GEOCN92.37%1182e-5940S ribosomal protein S26 OS=Geotrichum candidum GN=BN980_GECA08s04157g PE=3 SV=1
Q6C5A4_YARLI82.50%1202e-5540S ribosomal protein S26 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E19701g PE=3 SV=1
A0A167FBI6_9ASCO83.05%1187e-5540S ribosomal protein S26 OS=Sugiyamaella lignohabitans GN=RPS26B PE=3 SV=1
UniRef50_A0A167FBI683.05%1182e-5140S ribosomal protein S26 n=9 Tax=Dikarya TaxID=451864 RepID=A0A167FBI6_9ASCO
A0A1E4TE57_9ASCO83.76%1176e-5340S ribosomal protein S26 (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_15422 PE=3 SV=1
A0A1E3PNZ3_9ASCO77.68%1127e-4840S ribosomal protein S26 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_40138 PE=3 SV=1
Q5ALV6_CANAL70.09%1174e-4340S ribosomal protein S26 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS26A PE=3 SV=1
RS26B_YEAST65.83%1202e-4240S ribosomal protein S26-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS26B PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4379
Predicted cleavage: 30

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR000892
    Ribosomal protein S26e
    1. PF01283 (Ribosomal_...)
    2. PS00733 (RIBOSOMAL_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_01326_1
MPKKRANNGRSKKGRGHVSSIRCSNCARMVPKDKAIKRYMIRNMVEAAAIRDISEASVYKEYVLPKLYLKIHYCISCAIH
SKVVRVRSREGRRIRSPPPRVRYNKDGKKINPTVASKAVL

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome