Protein

MIA_04621_1

Length
199 amino acids


Browser: contig06:522849-523747-

Protein function

EGGNOG:0PHKHRPL16B60s ribosomal protein L16
SGD closest match:S000001395RPL16A60S ribosomal protein L16-A
CGD closest match:CAL0000175593RPL16ARibosomal 60S subunit protein L16A

Protein alignments

%idAln lengthE-value
MCA_04680_190.955%1993.17e-134MCA_04680_1
A0A0J9X6T5_GEOCN79.397%1993.67e-116Similar to Saccharomyces cerevisiae YNL069C RPL16B N-terminally acetylated protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA04s00483g PE=3 SV=1
Q6CCI0_YARLI75.000%2001.01e-107YALI0C09218p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C09218g PE=3 SV=1
A0A060T448_BLAAD75.500%2004.36e-105ARAD1C01782p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C01782g PE=3 SV=1
RL16A_YEAST71.357%1994.56e-10460S ribosomal protein L16-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL16A PE=1 SV=3
UniRef50_P2678471.357%1991.09e-10060S ribosomal protein L16-A n=436 Tax=Eukaryota TaxID=2759 RepID=RL16A_YEAST
A0A1E3PJE8_9ASCO80.814%1724.56e-95AMP dependent synthetase and ligase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_73999 PE=3 SV=1
Q5AB87_CANAL74.500%2007.57e-101Ribosomal 60S subunit protein L16A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL16A PE=3 SV=1
A0A167DJ44_9ASCO77.876%1136.21e-58Ribosomal 60S subunit protein L16A OS=Sugiyamaella lignohabitans GN=RPL16A PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1662
Predicted cleavage: 20

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. MF_01366 (Ribosomal...)
    2. SSF52161 (Ribosomal...)
    3. cd00392 (Ribosomal_L13)
    4. PF00572 (Ribosomal_L13)
    5. PIRSF002181 (RPL13p...)
    1. PS00783 (RIBOSOMAL_L13)

Residue annotation

  1. 23S rRNA interface...
  2. L3 interface cd00392

Protein sequence

>MIA_04621_1
MSSYPVVVIDGKGHLLGRLASIVAKQLLNGEKVVVVRAEALNISGELFRAKLKYHAYLRKGTRFNKTRGAFHFRAPSRIF
YKAVRGMIPHKTARGQEALENLEVYEGIPPAYTNKKRVVVPQALRVLRLKPGRKYTTVGRLASEVGWQYQDVVERLEERR
KVKSAAYWAKKKALIEKTVAAEKSLEGSETSKALAAFGY

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome
GO:0015934 large ribosomal subunit