Protein
MCA_04680_1
Length
199 amino acids
Browser: contigC:3709763-3710770+
RNA-seq: read pairs 56578, FPKM 3495.4, percentile rank 98.8% (100% = highest expression)
Protein function
| KEGG: | K02872 | RP-L13Ae | large subunit ribosomal protein L13Ae |
|---|---|---|---|
| EGGNOG: | 0PHKH | RPL16B | 60s ribosomal protein L16 |
| SGD closest match: | S000001395 | RPL16A | 60S ribosomal protein L16-A |
| CGD closest match: | CAL0000175593 | RPL16A | Ribosomal 60S subunit protein L16A |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04621_1 | 90.95% | 199 | 2e-132 | MIA_04621_1 |
| A0A0J9X6T5_GEOCN | 75.88% | 199 | 1e-111 | Similar to Saccharomyces cerevisiae YNL069C RPL16B N-terminally acetylated protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA04s00483g PE=3 SV=1 |
| Q6CCI0_YARLI | 73.50% | 200 | 1e-105 | YALI0C09218p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C09218g PE=3 SV=1 |
| A0A060T448_BLAAD | 73.50% | 200 | 2e-101 | ARAD1C01782p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C01782g PE=3 SV=1 |
| RL16A_YEAST | 70.35% | 199 | 7e-101 | 60S ribosomal protein L16-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL16A PE=1 SV=3 |
| UniRef50_P26784 | 70.35% | 199 | 2e-97 | 60S ribosomal protein L16-A n=436 Tax=Eukaryota TaxID=2759 RepID=RL16A_YEAST |
| A0A1E3PJE8_9ASCO | 77.33% | 172 | 2e-91 | AMP dependent synthetase and ligase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_73999 PE=3 SV=1 |
| Q5AB87_CANAL | 72.00% | 200 | 5e-97 | Ribosomal 60S subunit protein L16A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL16A PE=3 SV=1 |
| A0A167DJ44_9ASCO | 71.68% | 113 | 5e-53 | Ribosomal 60S subunit protein L16A OS=Sugiyamaella lignohabitans GN=RPL16A PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1766
Predicted cleavage: 20
Protein family membership
- Ribosomal protein L13 (IPR005822)
- Ribosomal protein L13, eukaryotic/archaeal (IPR005755)
Domains and repeats
None predicted.
Detailed signature matches
Residue annotation
-
23S rRNA interface...
-
L3 interface cd00392
Protein sequence
>MCA_04680_1 MSSYPVIVIDGKGHLLGRLASIVAKQLLNGEKIVVVRAEALNISGEFFRAKLKYLSYLRKGTRFNKTRGAFHFRAPSRIF YKAVRGMIPHKTARGQEALERLEVYEGIPPAYNNMKKVVVPQALRVLRLKPGRKYSTVGKLANEVGWKYQDVVERLEERR KVKSAAYWSKKKALIEKTIAAEQSLEGSETTKALAQFGY
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit