Protein

MIA_04570_1

Length
297 amino acids

Browser: contig06:385439-386333-

Protein function

EGGNOG:0QDTNFG01968.1RNA-binding La domain protein
SGD closest match:S000002209LHP1La protein homolog
CGD closest match:CAL0000195360LHP1Lhp1p

Protein alignments

%idAln lengthE-value
MCA_03972_167.308%2601.36e-114MCA_03972_1
A0A0J9X7Q6_GEOCN68.720%2111.77e-97Similar to Saccharomyces cerevisiae YDL051W LHP1 RNA binding protein required for maturation of tRNA and U6 snRNAs OS=Geotrichum candidum GN=BN980_GECA04s00230g PE=4 SV=1
A0A167EQA2_9ASCO66.190%2101.34e-92Lhp1p OS=Sugiyamaella lignohabitans GN=LHP1 PE=4 SV=1
UniRef50_A0A167EQA266.190%2103.69e-89Lhp1p n=6 Tax=Saccharomycetales TaxID=4892 RepID=A0A167EQA2_9ASCO
A0A060T426_BLAAD61.441%2361.81e-88ARAD1C40832p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C40832g PE=4 SV=1
A0A1E3PCH2_9ASCO60.099%2032.21e-74La-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84585 PE=4 SV=1
Q6C5E0_YARLI47.273%2205.36e-53YALI0E18854p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E18854g PE=4 SV=1
LHP1_YEAST41.176%1704.87e-33La protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LHP1 PE=1 SV=2
A0A1D8PE36_CANAL33.526%1731.80e-21Lhp1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LHP1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0098

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 297

Detailed signature matches

  1. Family IPR002344
    Lupus La protein
    1. PR00302 (LUPUSLA)
  2. Domain IPR011991
    Winged helix-turn-helix DNA-binding domain
    1. G3DSA:1.10.10.10
    2. SSF46785 ("Winged h...)
  3. Domain IPR006630
    La-type HTH domain
    1. PF05383 (La)
    2. SM00715 (la)
    3. PS50961 (HTH_LA)
  4. Domain IPR000504
    RNA recognition motif domain
    1. SSF54928 (RNA-bindi...)
    2. SM00360 (rrm1_1)
    3. PS50102 (RRM)
    4. PF00076 (RRM_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.70...
  2. cd08029 (LA_like_fu...)
  3. cd12291 (RRM1_La)
  4. mobidb-lite (disord...)

Residue annotation

  1. RNA binding site c...
  2. RNA binding site c...

Protein sequence

>MIA_04570_1
MSEQKEEQQVAPVETKQEESKVEAVEEPKAEEPKTEEPKTEESTQPKKRKNNIVSDPSTLPASSDPKEILKQVEFYFSDQ
NLPKDKFLLGLTKENEGWIPISTIATFSRMRRFSPLETIVAALRESQELLEVSENGELVRRKTPLEESAATEAAAATTEK
KPLSKGAQAFARSIYAKGFGEETPTSQYDIEKFFEAFAPVTQVRLRRADDKKFKGSVFVEFANLEDAQRFLAQDPKPKFN
DTDLLTMSKAAYVDMKSAEHGFNKNAKGGNRRGGHFNKKRRFDGNRNRENKKAKTEA

GO term prediction

Biological Process

GO:0006396 RNA processing

Molecular Function

GO:0003676 nucleic acid binding
GO:0003723 RNA binding

Cellular Component

GO:0005634 nucleus
GO:0030529 intracellular ribonucleoprotein complex