Protein

MIA_04552_1

Length
325 amino acids


Browser: contig06:343735-344784-

Protein function

EGGNOG:0PPU4K06691 26S proteasome regulatory subunit N13
SGD closest match:S000004413RPN1326S proteasome regulatory subunit RPN13
CGD closest match:CAL0000175707orf19.1058Proteasome regulatory particle lid subunit

Protein alignments

%idAln lengthE-value
MCA_02884_158.31%3071e-102MCA_02884_1
A0A0J9X3L3_GEOCN38.85%3144e-64Similar to Saccharomyces cerevisiae YLR421C RPN13 Subunit of the 19S regulatory particle of the 26S proteasome lid OS=Geotrichum candidum GN=BN980_GECA01s10812g PE=4 SV=1
UniRef50_A0A0J9X3L338.85%3149e-61Similar to Saccharomyces cerevisiae YLR421C RPN13 Subunit of the 19S regulatory particle of the 26S proteasome lid n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X3L3_GEOCN
A0A1E3PFZ0_9ASCO33.33%3302e-43Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_27645 PE=4 SV=1
A0A060T6J5_BLAAD32.49%3172e-42ARAD1B12694p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B12694g PE=4 SV=1
Q6CF86_YARLI31.49%3087e-35YALI0B09339p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B09339g PE=4 SV=1
A0A1E4TLI8_9ASCO30.00%3102e-32Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_43199 PE=4 SV=1
A0A161HJM4_9ASCO44.62%1302e-27Proteasome regulatory particle lid subunit RPN13 OS=Sugiyamaella lignohabitans GN=RPN13 PE=4 SV=1
A0A1D8PDB0_CANAL36.11%1081e-14Proteasome regulatory particle lid subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1058 PE=4 SV=1
RPN13_YEAST32.58%1323e-1526S proteasome regulatory subunit RPN13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN13 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0648

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 325

Detailed signature matches

    1. PF04683 (Proteasom_...)
    1. PF16550 (RPN13_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_04552_1
MAFETILNFAAGYATYDDATKTVTPRPGPGRITVSKDPQEPYYSFAWEPRDGFEPPETVTAREPLLLIPGDAQWTHCRSK
TNGRVFALKFQSSDQREFFWMQARTDAKDKNPATLSSEDKLILATFQKILTEDEDEDMEDQDDDEAAATSSSTTADSLGA
AAPASKSEDSSDQNAASSFTSGPQWDSFVKSVAEQVRKRTEETSGDFPILSISNAFSPSDFIAYVQSASAAQLAPLYGQL
PEEIPRNKDELERVIRSSQFAQGVESLSAVLRQGGLGHVLASELDFPYQGEGVAGYLNGIYQGEKARAEKKDEPREDKDG
DESME

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

GO:0005634 nucleus
GO:0005737 cytoplasm