Protein
MCA_02884_1
Length
311 amino acids
Gene name: RPN13
Description: 26S proteasome regulatory subunit RPN13; Subunit of the 19S regulatory particle of the 26S proteasome lid; acts as a ubiquitin receptor for the proteasome
Browser: contigB:2625730-2626926-
RNA-seq: read pairs 3738, FPKM 148.0, percentile rank 84.7% (100% = highest expression)
Protein function
| Annotation: | RPN13 | 26S proteasome regulatory subunit RPN13; Subunit of the 19S regulatory particle of the 26S proteasome lid; acts as a ubiquitin receptor for the proteasome | |
|---|---|---|---|
| KEGG: | K06691 | RPN13 | 26S proteasome regulatory subunit N13 |
| EGGNOG: | 0PPU4 | K06691 26S proteasome regulatory subunit N13 | |
| SGD closest match: | S000004413 | RPN13 | 26S proteasome regulatory subunit RPN13 |
| CGD closest match: | CAL0000175707 | orf19.1058 | Proteasome regulatory particle lid subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04552_1 | 52.10% | 309 | 4e-94 | MIA_04552_1 |
| A0A0J9XA41_GEOCN | 61.54% | 130 | 2e-53 | Similar to Saccharomyces cerevisiae YLR421C RPN13 Subunit of the 19S regulatory particle of the 26S proteasome lid OS=Geotrichum candidum GN=BN980_GECA06s04311g PE=4 SV=1 |
| UniRef50_A0A0J9XA41 | 61.54% | 130 | 4e-50 | Similar to Saccharomyces cerevisiae YLR421C RPN13 Subunit of the 19S regulatory particle of the 26S proteasome lid n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XA41_GEOCN |
| A0A161HJM4_9ASCO | 44.88% | 127 | 2e-29 | Proteasome regulatory particle lid subunit RPN13 OS=Sugiyamaella lignohabitans GN=RPN13 PE=4 SV=1 |
| Q6CF86_YARLI | 43.08% | 130 | 1e-22 | YALI0B09339p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B09339g PE=4 SV=1 |
| A0A1E3PCY0_9ASCO | 40.15% | 132 | 4e-23 | Uncharacterized protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_11889 PE=4 SV=1 |
| A0A060T6J5_BLAAD | 36.84% | 133 | 6e-21 | ARAD1B12694p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B12694g PE=4 SV=1 |
| A0A1E4TLI8_9ASCO | 37.98% | 129 | 6e-19 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_43199 PE=4 SV=1 |
| A0A1D8PDB0_CANAL | 40.68% | 118 | 1e-17 | Proteasome regulatory particle lid subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1058 PE=4 SV=1 |
| RPN13_YEAST | 33.87% | 124 | 1e-16 | 26S proteasome regulatory subunit RPN13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN13 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0477
Protein family membership
Domains and repeats
-
Domain
1
50
100
150
200
250
311
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_02884_1 MTIVTVLSFSAGYATYDESTKTVTPRPGPGKITITKNPEEPYYSFKWEPRDGFEPTDHVSATDIDLLIPGDAKWIHCKNC TTGRVFVLKFNSSDRKEFFWMQSRTDAKDRNVASLSTEDQRIAATFEKILADDEEEEEEDEDLMEQDEPASSSQPANSTD NSDPNALTTENPQLASLIKSMSNRLRHSQKLASSSSSSFPILSLSDAFSSSDFIDYVNGISSEKELEPLLSLLPENVEKS KEELIRVIRSSQFAQGVESLSHALRQGGLGHVIANELEFPYQGEGIEGYLTGLYQGDKSKKKEKDDEEMED
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm