Protein

MIA_04534_1

Length
87 amino acids


Browser: contig06:276594-276965+

Protein function

EGGNOG:0PQS0RPS21Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Has a physiological role leading to 18S rRNA stability (By similarity)
SGD closest match:S000001765RPS21A40S ribosomal protein S21-A

Protein alignments

%idAln lengthE-value
MCA_05893_186.207%871.45e-53MCA_05893_1
A0A1E3PHV1_9ASCO79.310%872.59e-5040S ribosomal protein S21 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83078 PE=3 SV=1
A0A060TCG6_BLAAD78.161%873.29e-5040S ribosomal protein S21 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D39138g PE=3 SV=1
A0A0F7RQF2_GEOCN79.310%871.56e-4940S ribosomal protein S21 OS=Geotrichum candidum GN=BN980_GECA05s01726g PE=3 SV=1
Q6C959_YARLI77.011%871.76e-4840S ribosomal protein S21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D13794g PE=3 SV=1
A0A1D8PCG7_CANAL77.011%871.37e-4740S ribosomal protein S21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS21B PE=3 SV=1
RS21A_YEAST74.713%871.13e-4540S ribosomal protein S21-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS21A PE=1 SV=1
UniRef50_P0C0V874.713%872.71e-4240S ribosomal protein S21-A n=274 Tax=Eukaryota TaxID=2759 RepID=RS21A_YEAST

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0556

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF01249 (Ribosomal_...)
    2. PIRSF002148 (RPS21e)

Protein sequence

>MIA_04534_1
MENEQGVLVELYIPRKCDATNRIIKAKDHASVQINIADVDEFGRAIAGKNTTYSICGYIRSKAESDDSLNRLAQQDGLLK
NVFSYRR

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome