Protein

MCA_05893_1

Length
87 amino acids

Browser: contigD:2666050-2666751+

RNA-seq: read pairs 30559, FPKM 4290.8, percentile rank 99.3% (100% = highest expression)

Protein function

KEGG:K02971RP-S21e small subunit ribosomal protein S21e
EGGNOG:0PQS0RPS21Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Has a physiological role leading to 18S rRNA stability (By similarity)
SGD closest match:S000003672RPS21B40S ribosomal protein S21-B

Protein alignments

%idAln lengthE-value
MIA_04534_186.21%874e-52MIA_04534_1
A0A060TCG6_BLAAD75.86%872e-4740S ribosomal protein S21 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D39138g PE=3 SV=1
A0A1D8PCG7_CANAL74.71%871e-4540S ribosomal protein S21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS21B PE=3 SV=1
A0A1E3PHV1_9ASCO75.86%874e-4540S ribosomal protein S21 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83078 PE=3 SV=1
A0A0F7RQF2_GEOCN74.71%877e-4540S ribosomal protein S21 OS=Geotrichum candidum GN=BN980_GECA05s01726g PE=3 SV=1
RS21B_YEAST74.71%875e-4540S ribosomal protein S21-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS21B PE=1 SV=1
Q6C959_YARLI73.56%879e-4540S ribosomal protein S21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D13794g PE=3 SV=1
UniRef50_P0C0V873.56%872e-4140S ribosomal protein S21-A n=274 Tax=Eukaryota TaxID=2759 RepID=RS21A_YEAST

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0156

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR001931
    Ribosomal protein S21e
    1. PF01249 (Ribosomal_...)
    2. PD006584
    3. PIRSF002148 (RPS21e)

Protein sequence

>MCA_05893_1
MENESGNIVELYIPRKCDATNRIIKAKDHASVQINIVDIDENGRAIPGKNITYNLCGFVRSKAESDDSLNRLAQQDGLLK
NVFSYRR

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome