Protein

MIA_04514_1

Length
219 amino acids

Browser: contig06:225335-226299-

Protein function

EGGNOG:0PFUBPRE3The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)
SGD closest match:S000003538PRE3Proteasome subunit beta type-1
CGD closest match:CAL0000200252PRE3Proteasome core particle subunit beta 1

Protein alignments

%idAln lengthE-value
MCA_00803_286.070%2011.45e-127MCA_00803_2
A0A0J9XIC9_GEOCN73.869%1997.77e-111Similar to Saccharomyces cerevisiae YJL001W PRE3 Beta 1 subunit of the 20S proteasome, responsible for cleavage after acidic residues in peptides OS=Geotrichum candidum GN=BN980_GECA19s01187g PE=4 SV=1
A0A060SZW3_BLAAD74.611%1931.16e-109ARAD1C03740p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C03740g PE=4 SV=1
A0A1E3PL51_9ASCO74.227%1943.09e-106Proteasome-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46601 PE=4 SV=1
Q6C1N0_YARLI70.051%1979.43e-105YALI0F14861p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F14861g PE=4 SV=1
PSB1_YEAST68.041%1943.78e-98Proteasome subunit beta type-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE3 PE=1 SV=2
UniRef50_P3862468.041%1949.04e-95Proteasome subunit beta type-1 n=30 Tax=Opisthokonta TaxID=33154 RepID=PSB1_YEAST
A0A1E4TFP1_9ASCO68.394%1937.13e-96Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2268 PE=4 SV=1
A0A1D8PK85_CANAL67.010%1944.35e-92Proteasome core particle subunit beta 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRE3 PE=4 SV=1
A0A161HLV6_9ASCO72.826%925.71e-46Proteasome core particle subunit beta 1 OS=Sugiyamaella lignohabitans GN=PRE3 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1278
Predicted cleavage: 17

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 200 219

Detailed signature matches

  1. Family IPR001353
    Proteasome, subunit alpha/beta
    1. PF00227 (Proteasome)
  2. Family IPR023333
    Proteasome B-type subunit
    1. PS51476 (PROTEASOME...)
  3. Family IPR000243
    Peptidase T1A, proteasome beta-subunit
    1. PR00141 (PROTEASOME)
  4. Domain IPR029055
    Nucleophile aminohydrolases, N-terminal
    1. G3DSA:3.60.20.10
    2. SSF56235 (N-termina...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SignalP-noTM
  2. cd03762 (proteasome...)

Residue annotation

  1. active site cd03762
  2. beta subunit inter...

Protein sequence

>MIA_04514_1
MAITTIRFLVLELLSLHSMAVVFDGGVILGADSRTTTGSFIANRVTDKLTKVHDKIWCFYRSGSAADTQAVADIVKYHLS
LYSAQNNRAPTPQIASAVFQELCYNNKDNLTAGIIVAGFNESTGAGEVYSVPLGGSIHKAEYAIAGSGSSYIYGYCDQKF
KSGMTKEEAIQFVKTSLAEAIKWDGSSGGVIRLAILTAGPTERHVFYPEEYRSEYVNHY

GO term prediction

Biological Process

GO:0051603 proteolysis involved in cellular protein catabolic process

Molecular Function

GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity

Cellular Component

GO:0005839 proteasome core complex