Protein
MCA_00803_2
Length
221 amino acids
Gene name: PRE3
Description: Proteasome subunit beta type-1
Browser: contigA:2503689-2504867-
RNA-seq: read pairs 4554, FPKM 253.5, percentile rank 90.5% (100% = highest expression)
Protein function
| Annotation: | PRE3 | Proteasome subunit beta type-1 | |
|---|---|---|---|
| KEGG: | K02738 | PSMB6 | 20S proteasome subunit beta 1 [EC:3.4.25.1] |
| EGGNOG: | 0PFUB | PRE3 | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity) |
| SGD closest match: | S000003538 | PRE3 | Proteasome subunit beta type-1 |
| CGD closest match: | CAL0000200252 | PRE3 | Proteasome core particle subunit beta 1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XIC9_GEOCN | 78.08% | 219 | 5e-134 | Similar to Saccharomyces cerevisiae YJL001W PRE3 Beta 1 subunit of the 20S proteasome, responsible for cleavage after acidic residues in peptides OS=Geotrichum candidum GN=BN980_GECA19s01187g PE=4 SV=1 |
| A0A060SZW3_BLAAD | 81.69% | 213 | 5e-134 | ARAD1C03740p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C03740g PE=4 SV=1 |
| A0A1E3PL51_9ASCO | 80.37% | 214 | 1e-131 | Proteasome-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46601 PE=4 SV=1 |
| Q6C1N0_YARLI | 75.12% | 217 | 2e-126 | YALI0F14861p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F14861g PE=4 SV=1 |
| MIA_04514_1 | 86.07% | 201 | 8e-126 | MIA_04514_1 |
| PSB1_YEAST | 73.83% | 214 | 6e-120 | Proteasome subunit beta type-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE3 PE=1 SV=2 |
| UniRef50_P38624 | 73.83% | 214 | 1e-116 | Proteasome subunit beta type-1 n=30 Tax=Opisthokonta TaxID=33154 RepID=PSB1_YEAST |
| A0A1E4TFP1_9ASCO | 72.77% | 213 | 1e-116 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2268 PE=4 SV=1 |
| A0A1D8PK85_CANAL | 71.96% | 214 | 2e-113 | Proteasome core particle subunit beta 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRE3 PE=4 SV=1 |
| A0A161HLV6_9ASCO | 74.73% | 91 | 4e-47 | Proteasome core particle subunit beta 1 OS=Sugiyamaella lignohabitans GN=PRE3 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0084
Protein family membership
- Proteasome, subunit alpha/beta (IPR001353)
- Proteasome B-type subunit (IPR023333)
- Peptidase T1A, proteasome beta-subunit (IPR000243)
- Proteasome B-type subunit (IPR023333)
Domains and repeats
-
Domain
1
50
100
150
221
Detailed signature matches
no IPR
Unintegrated signatures
-
cd03762 (proteasome...)
Residue annotation
-
active site cd03762
-
beta subunit inter...
Protein sequence
>MCA_00803_2 MNGISVDVNHLKKGEVNLGTSIMAVKFDGGVILGADSRTTTGSFIANRVTDKLTKVHDKVWCCRSGSAADTQAVADIVKY HLNLYSAQHNRTPTPYIASALFQEICYNNKDNLTAGIIVAGYDKKTGGEVYSVPLGGSLHKAEYAIAGSGSTFIYGYCDQ HFKSNMTKEEAIAFVKTSLAEAIKWDGSSGGVIRMVILTDEPTERLVFYPDEYRTEYVNHY
GO term prediction
Biological Process
GO:0051603 proteolysis involved in cellular protein catabolic process
Molecular Function
GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity
Cellular Component
GO:0005839 proteasome core complex