Protein
MIA_04509_1
Length
186 amino acids
Browser: contig06:216436-217052+
Protein function
| EGGNOG: | 0PN0Y | PGUG_01839 | translation machinery-associated protein 16 |
|---|---|---|---|
| SGD closest match: | S000005778 | TMA16 | Translation machinery-associated protein 16 |
| CGD closest match: | CAL0000197859 | orf19.4793 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_04985_1 | 43.011% | 186 | 1.94e-36 | MCA_04985_1 |
| A0A060T5D5_BLAAD | 45.714% | 175 | 1.40e-31 | ARAD1B03674p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B03674g PE=4 SV=1 |
| A0A1E3PQY5_9ASCO | 40.426% | 188 | 5.76e-26 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_40497 PE=4 SV=1 |
| UniRef50_F2QM57 | 41.243% | 177 | 1.36e-21 | Ribosome associating protein n=3 Tax=Komagataella TaxID=460517 RepID=F2QM57_KOMPC |
| TMA16_YEAST | 36.364% | 154 | 1.11e-21 | Translation machinery-associated protein 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMA16 PE=1 SV=2 |
| Q5APH1_CANAL | 36.508% | 189 | 1.06e-18 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4793 PE=4 SV=1 |
| Q6C8G1_YARLI | 38.286% | 175 | 1.17e-17 | YALI0D19954p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D19954g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.8647
Protein family membership
- Translation machinery-associated protein 16 (IPR021346)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_04509_1 MPVAKSLKKVSKKVKGSDKSLHPNGRKFKQLNRATLREEKLAKQKSERSSHRDQKRNTKTNFAIVLRYKHFQETLKESGK TTLSDDELRAAIQAFIARDNTTLEEYKAARRPGRPASSAQDALELRIKREQQELRSGFEAPDLADKANAEMFAAWTGTAG GLSTIKKVRVTETSVIRNVKDVDMED
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.