Protein
MCA_04985_1
Length
199 amino acids
Gene name: TMA16
Description: Translation machinery-associated protein 16
Browser: contigD:32518-33224+
RNA-seq: read pairs 573, FPKM 35.4, percentile rank 57.4% (100% = highest expression)
Protein function
| Annotation: | TMA16 | Translation machinery-associated protein 16 | |
|---|---|---|---|
| KEGG: | K14860 | TMA16 | translation machinery-associated protein 16 |
| EGGNOG: | 0PN0Y | PGUG_01839 | translation machinery-associated protein 16 |
| SGD closest match: | S000005778 | TMA16 | Translation machinery-associated protein 16 |
| CGD closest match: | CAL0000197859 | orf19.4793 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04509_1 | 46.38% | 207 | 2e-47 | MIA_04509_1 |
| A0A1E3PQY5_9ASCO | 48.59% | 177 | 3e-46 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_40497 PE=4 SV=1 |
| A0A060T5D5_BLAAD | 45.00% | 180 | 3e-46 | ARAD1B03674p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B03674g PE=4 SV=1 |
| Q6C8G1_YARLI | 41.52% | 171 | 2e-34 | YALI0D19954p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D19954g PE=4 SV=1 |
| UniRef50_Q6C8G1 | 41.52% | 171 | 5e-31 | YALI0D19954p n=2 Tax=Yarrowia lipolytica TaxID=4952 RepID=Q6C8G1_YARLI |
| TMA16_YEAST | 36.26% | 171 | 6e-27 | Translation machinery-associated protein 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMA16 PE=1 SV=2 |
| Q5APH1_CANAL | 33.72% | 172 | 4e-24 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4793 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7422
Protein family membership
- Translation machinery-associated protein 16 (IPR021346)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_04985_1 MPVSKSLKKVSKKVQGHEKNLHPNGRKFKQLNRANLRQEKLDKNRHERINVNEAKILRFKYLQEAVKLILKEKSADGKDV TINDIITPISENEIIEVIETFLKRDDDVLEKMKSERRPGRPASTKQDQLQQRIDKEWAEYKTGFLIPDLTDVENIKMFLT WNGSVGGLNIIKKARITKNGLIKSQKQDDKNTIKDVEMI
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.