Protein
MIA_04500_1
Length
269 amino acids
Browser: contig06:197149-197959+
Protein function
| EGGNOG: | 0PJ7M | DCP1 | Component of the decapping complex necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Decapping is the major pathway of mRNA degradation in yeast. It occurs through deadenylation, decapping and subsequent 5' to 3' exonucleolytic decay of the transcript body |
|---|---|---|---|
| SGD closest match: | S000005509 | DCP1 | mRNA-decapping enzyme subunit 1 |
| CGD closest match: | CAL0000197764 | orf19.423 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_04333_1 | 57.143% | 168 | 9.75e-64 | MCA_04333_1 |
| A0A060TBC3_BLAAD | 36.416% | 173 | 6.23e-39 | ARAD1D34056p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D34056g PE=4 SV=1 |
| A0A0J9YHA1_GEOCN | 36.316% | 190 | 4.88e-37 | Similar to Saccharomyces cerevisiae YOL149W DCP1 Subunit of the Dcp1p-Dcp2p decapping enzyme complex OS=Geotrichum candidum GN=BN980_GECA01s01374g PE=4 SV=1 |
| UniRef50_A0A0J9YHA1 | 36.316% | 190 | 9.98e-34 | Similar to Saccharomyces cerevisiae YOL149W DCP1 Subunit of the Dcp1p-Dcp2p decapping enzyme complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9YHA1_GEOCN |
| A0A167FKM2_9ASCO | 32.317% | 164 | 5.86e-29 | Dcp1p OS=Sugiyamaella lignohabitans GN=DCP1 PE=4 SV=1 |
| Q6C1J6_YARLI | 30.939% | 181 | 4.06e-22 | YALI0F15719p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F15719g PE=4 SV=1 |
| Q5A2B8_CANAL | 25.137% | 183 | 9.14e-16 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.423 PE=4 SV=1 |
| A0A1E3PRV9_9ASCO | 30.827% | 133 | 5.36e-16 | PH domain-like protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_44670 PE=4 SV=1 |
| DCP1_YEAST | 24.057% | 212 | 4.51e-15 | mRNA-decapping enzyme subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCP1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.4161
Predicted cleavage: 35
Protein family membership
- mRNA-decapping enzyme subunit 1 (IPR010334)
Domains and repeats
-
Domain
1
50
100
150
200
269
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_04500_1 MPNIPSGPGSQSSNGSSSSSSGKRRLGTSRRSRAQGTESRGPGSERTPSGRSSRAHNRSSGSNNGSINNNNNIYNNNNNT NNGSNNKNNTVSTVAKSKTLDETAKYYINYGVLALHDPKLGQIFLATTVCNVYVYDYDTEGWNKSFCQGPLFLYSRVVPE SSSLEAGDNGGGDGALGSTNSEQYEDDPGTYAPYALLVLNRLSLDNFSLAVTPKSVAAKRGVETVSMYRDGDFLIVQSPD DTTYGIYLYKEAERANLLSTVEWCLNVDL
GO term prediction
Biological Process
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0043085 positive regulation of catalytic activity
Molecular Function
GO:0008047 enzyme activator activity
Cellular Component
None predicted.