Protein
MCA_04333_1
Length
292 amino acids
Description: Putative mRNA-decapping enzyme subunit
Browser: contigC:2731316-2732195+
RNA-seq: read pairs 1581, FPKM 66.7, percentile rank 71.5% (100% = highest expression)
Protein function
| Annotation: | Putative mRNA-decapping enzyme subunit | ||
|---|---|---|---|
| EGGNOG: | 0PJ7M | DCP1 | Component of the decapping complex necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Decapping is the major pathway of mRNA degradation in yeast. It occurs through deadenylation, decapping and subsequent 5' to 3' exonucleolytic decay of the transcript body |
| CGD closest match: | CAL0000197764 | orf19.423 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04500_1 | 57.14% | 168 | 8e-63 | MIA_04500_1 |
| A0A0J9YHA1_GEOCN | 36.32% | 190 | 3e-35 | Similar to Saccharomyces cerevisiae YOL149W DCP1 Subunit of the Dcp1p-Dcp2p decapping enzyme complex OS=Geotrichum candidum GN=BN980_GECA01s01374g PE=4 SV=1 |
| UniRef50_A0A0J9YHA1 | 36.32% | 190 | 5e-32 | Similar to Saccharomyces cerevisiae YOL149W DCP1 Subunit of the Dcp1p-Dcp2p decapping enzyme complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9YHA1_GEOCN |
| A0A060TBC3_BLAAD | 38.22% | 157 | 3e-34 | ARAD1D34056p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D34056g PE=4 SV=1 |
| A0A167FKM2_9ASCO | 37.25% | 153 | 2e-31 | Dcp1p OS=Sugiyamaella lignohabitans GN=DCP1 PE=4 SV=1 |
| Q6C1J6_YARLI | 32.08% | 159 | 8e-20 | YALI0F15719p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F15719g PE=4 SV=1 |
| A0A1E3PRV9_9ASCO | 33.33% | 132 | 9e-17 | PH domain-like protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_44670 PE=4 SV=1 |
| A0A1E4T9C3_9ASCO | 30.14% | 146 | 4e-14 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_144647 PE=4 SV=1 |
| Q5A2B8_CANAL | 26.26% | 179 | 1e-13 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.423 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9349
Protein family membership
- mRNA-decapping enzyme subunit 1 (IPR010334)
Domains and repeats
-
Domain
1
50
100
150
200
250
292
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_04333_1 MSSNPISRSSTPKKRSKKSKPQSSSSLSNNNASSSQKSKPSSLGNSHYSQNQNGYPEFNQFDQQINRSQAPSRNSKNIRP KSSASPAPRETRLNYSSGYESNSDNYKAHKQHKQQQQQKIVAKPTSYPEEQFQAAKYYLNTHVLRLHDKQLGNIFYTTTV CNIYVFDVETEGWNKSYCQGPLFLYSRITQIKDAENDNEVFCKNEDGTVNYGAFAPYSLMALNRLSLDNFSLAVTPKSIA NRLGVETIEIYRDGDFLIVKSPDGIMYGIYLFKEEERKMLLEGIQWCLDVQM
GO term prediction
Biological Process
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0043085 positive regulation of catalytic activity
Molecular Function
GO:0008047 enzyme activator activity
Cellular Component
None predicted.