Protein
MIA_04468_1
Length
300 amino acids
Browser: contig06:119390-120293-
Protein function
| EGGNOG: | 0PQKV | HAP2 | CCAAT-binding transcription factor subunit HAPB |
|---|---|---|---|
| SGD closest match: | S000003206 | HAP2 | Transcriptional activator HAP2 |
| CGD closest match: | CAL0000184546 | HAP2 | Hap2p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02763_1 | 94.030% | 67 | 2.52e-38 | MCA_02763_1 |
| A0A0J9X948_GEOCN | 92.754% | 69 | 1.18e-38 | Similar to Saccharomyces cerevisiae YGL237C HAP2 Subunit of the heme-activated, glucose-repressed Hap2p/3p/4p/5p CCAAT-binding complex OS=Geotrichum candidum GN=BN980_GECA05s05235g PE=4 SV=1 |
| UniRef50_A0A0J9X948 | 92.754% | 69 | 2.41e-35 | Similar to Saccharomyces cerevisiae YGL237C HAP2 Subunit of the heme-activated, glucose-repressed Hap2p/3p/4p/5p CCAAT-binding complex n=3 Tax=Fungi TaxID=4751 RepID=A0A0J9X948_GEOCN |
| A0A060TEL4_BLAAD | 95.161% | 62 | 2.81e-37 | ARAD1D08690p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D08690g PE=4 SV=1 |
| A0A167EJT6_9ASCO | 95.161% | 62 | 2.75e-37 | Hap2p OS=Sugiyamaella lignohabitans GN=HAP2 PE=4 SV=1 |
| Q6C0N7_YARLI | 94.915% | 59 | 3.21e-35 | YALI0F23111p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F23111g PE=4 SV=1 |
| A0A1D8PE35_CANAL | 91.525% | 59 | 2.42e-33 | Hap2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAP2 PE=4 SV=1 |
| HAP2_YEAST | 85.000% | 60 | 2.88e-31 | Transcriptional activator HAP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP2 PE=1 SV=1 |
| A0A1E3PN41_9ASCO | 77.612% | 67 | 1.55e-31 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_65245 PE=4 SV=1 |
| A0A1E4TBM7_9ASCO | 79.661% | 59 | 9.93e-28 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_45606 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0126
Protein family membership
- Nuclear transcription factor Y subunit A (IPR001289)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS00686 (NFYA_HAP2_1)
-
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_04468_1 MDNSGEAAEQPFYVNAKQYHRILKRRIARAKLEESLNVARGRRPYLHESRHKHAMRRPRGQGGRFLTAAEIAERERKEAE ERRSKEEGGSEKTPGSEDGRNMGEQENGAAVAASTRNGNSAEISSGKSSSDGSIAAAEPLLTLHPMSNKPLFENNKSNEN TNGSNTNNTINEDMSNTNSSNSNNSNNDNTSNTNNDHQPNEANDQQQLNENSRSADATINRTGSVGFQVSASSSSKVSPG TSSGTRTLSNNSSSSSSSSFADGLVGLPLGPAGGALKQDGDGTNGLPSHLAGSAQQLISS
GO term prediction
Biological Process
GO:0006355 regulation of transcription, DNA-templated
Molecular Function
GO:0003677 DNA binding
GO:0003700 transcription factor activity, sequence-specific DNA binding
Cellular Component
GO:0016602 CCAAT-binding factor complex