Protein
MCA_02763_1
Length
176 amino acids
Gene name: HAP2
Description: Transcriptional activator HAP2
Browser: contigB:2310337-2310868+
RNA-seq: read pairs 181, FPKM 12.6, percentile rank 30.3% (100% = highest expression)
Protein function
| Annotation: | HAP2 | Transcriptional activator HAP2 | |
|---|---|---|---|
| EGGNOG: | 0PQKV | HAP2 | CCAAT-binding transcription factor subunit HAPB |
| SGD closest match: | S000003206 | HAP2 | Transcriptional activator HAP2 |
| CGD closest match: | CAL0000184546 | HAP2 | Hap2p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A060TEL4_BLAAD | 91.36% | 81 | 4e-45 | ARAD1D08690p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D08690g PE=4 SV=1 |
| UniRef50_A0A060TEL4 | 91.36% | 81 | 1e-41 | ARAD1D08690p n=2 Tax=Trichomonascaceae TaxID=410830 RepID=A0A060TEL4_BLAAD |
| Q6C0N7_YARLI | 93.15% | 73 | 3e-39 | YALI0F23111p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F23111g PE=4 SV=1 |
| MIA_04468_1 | 94.37% | 71 | 2e-36 | MIA_04468_1 |
| A0A1E3PMG1_9ASCO | 80.26% | 76 | 1e-36 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46037 PE=4 SV=1 |
| A0A167EJT6_9ASCO | 94.12% | 68 | 4e-36 | Hap2p OS=Sugiyamaella lignohabitans GN=HAP2 PE=4 SV=1 |
| A0A0J9X948_GEOCN | 93.24% | 74 | 5e-37 | Similar to Saccharomyces cerevisiae YGL237C HAP2 Subunit of the heme-activated, glucose-repressed Hap2p/3p/4p/5p CCAAT-binding complex OS=Geotrichum candidum GN=BN980_GECA05s05235g PE=4 SV=1 |
| A0A1D8PE35_CANAL | 88.24% | 68 | 5e-34 | Hap2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAP2 PE=4 SV=1 |
| HAP2_YEAST | 85.94% | 64 | 2e-30 | Transcriptional activator HAP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP2 PE=1 SV=1 |
| A0A1E4TBM7_9ASCO | 67.05% | 88 | 1e-30 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_45606 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0253
Protein family membership
- Nuclear transcription factor Y subunit A (IPR001289)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS00686 (NFYA_HAP2_1)
-
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_02763_1 MDNGEPAEQPFYVNAKQYHRILKRRAARAKLEESLKVARGRRPYLHESRHKHAMRRPRGQGGRFLTAAEIAERDRKEAEE RIKQEQQAAGTVTNGEEPQQQNNGEEVSQQQHQQQQQQQQPNDGTAVNGSSDIQQYMNGTDDDKTLIKENDTQAYDVSKT VQENDDGTRQPPLISL
GO term prediction
Biological Process
GO:0006355 regulation of transcription, DNA-templated
Molecular Function
GO:0003677 DNA binding
GO:0003700 transcription factor activity, sequence-specific DNA binding
Cellular Component
GO:0016602 CCAAT-binding factor complex