Protein

MIA_04397_1

Length
124 amino acids

Browser: contig05:1598969-1599344+

Protein function

EGGNOG:0PNV6ATG8Involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. May mediate the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton (By similarity)
SGD closest match:S000000174ATG8Autophagy-related protein 8
CGD closest match:CAL0000182486ATG8Autophagy-related protein 8

Protein alignments

%idAln lengthE-value
MCA_04941_191.80%1221e-79MCA_04941_1
A0A060TA35_BLAAD87.07%1163e-73Autophagy-related protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C41976g PE=3 SV=1
A0A0J9X4Y0_GEOCN84.87%1195e-72Autophagy-related protein OS=Geotrichum candidum GN=BN980_GECA02s01319g PE=3 SV=1
A0A1E3PS18_9ASCO85.34%1167e-72Autophagy-related protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_20327 PE=3 SV=1
UniRef50_Q2UBH584.62%1176e-67Autophagy-related protein 8 n=39 Tax=Eukaryota TaxID=2759 RepID=ATG8_ASPOR
ATG8_YARLI82.05%1174e-69Autophagy-related protein 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG8 PE=3 SV=2
ATG8_YEAST80.17%1167e-66Autophagy-related protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG8 PE=1 SV=1
ATG8_CANAL77.31%1191e-65Autophagy-related protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG8 PE=2 SV=1
A0A1E4THE0_9ASCO76.07%1173e-63Autophagy-related protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_25107 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0643

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 124

Detailed signature matches

  1. Family IPR004241
    Autophagy protein Atg8 ubiquitin-like
    1. PF02991 (Atg8)
    2. cd01611 (GABARAP)
  2. Domain IPR029071
    Ubiquitin-related domain
    1. SSF54236 (Ubiquitin...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.10.20.90

Residue annotation

  1. predicted tubulin ...
  2. predicted ATG7 bin...

Protein sequence

>MIA_04397_1
MRSQFKEEHSFETRKAEAERIRHKYHDRIPVICEKVEKSDIPPIDKRKYLVPSDLTVGQFVYVIRKRIRLAPEKAVFIFV
NDVLPPTAALMSSIYQEHKDPDGFLYITYSGENTFGEDILDGSL

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.