Protein

MCA_04941_1

Length
128 amino acids


Gene name: ATG8

Description: Autophagy-related protein 8

Browser: contigC:4483314-4483808-

RNA-seq: read pairs 1454, FPKM 139.3, percentile rank 84.0% (100% = highest expression)

Protein function

Annotation:ATG8Autophagy-related protein 8
KEGG:K08341GABARAP GABA(A) receptor-associated protein
EGGNOG:0PNV6ATG8Involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. May mediate the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton (By similarity)
SGD closest match:S000000174ATG8Autophagy-related protein 8
CGD closest match:CAL0000182486ATG8Autophagy-related protein 8

Protein alignments

%idAln lengthE-value
MIA_04397_191.80%1221e-79MIA_04397_1
A0A060TA35_BLAAD85.34%1161e-71Autophagy-related protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C41976g PE=3 SV=1
A0A1E3PS18_9ASCO83.62%1162e-70Autophagy-related protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_20327 PE=3 SV=1
A0A0J9X4Y0_GEOCN83.19%1194e-70Autophagy-related protein OS=Geotrichum candidum GN=BN980_GECA02s01319g PE=3 SV=1
ATG8_YARLI80.51%1184e-69Autophagy-related protein 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG8 PE=3 SV=2
UniRef50_Q2UBH582.20%1186e-65Autophagy-related protein 8 n=39 Tax=Eukaryota TaxID=2759 RepID=ATG8_ASPOR
ATG8_CANAL77.78%1173e-65Autophagy-related protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG8 PE=2 SV=1
ATG8_YEAST77.78%1173e-64Autophagy-related protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG8 PE=1 SV=1
A0A1E4THE0_9ASCO70.97%1247e-63Autophagy-related protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_25107 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0750

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 128

Detailed signature matches

    1. PF02991 (Atg8)
    2. cd01611 (GABARAP)
    1. SSF54236 (Ubiquitin...)
Unintegrated signatures no IPR
Unintegrated signatures

Residue annotation

  1. predicted tubulin ...
  2. predicted ATG7 bin...

Protein sequence

>MCA_04941_1
MRSQFKEEHSFETRKAEAERIRHKYNDRIPVICEKVEKSDIPPIDKRKYLVPSDLTVGQFLYVIRKRISLSAEKAVFIFV
NDVLPPTAALMSTIYQEHKDPDGFLYITYSGENTFGKIIFDNLFDDDM

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.