Protein
MCA_04941_1
Length
128 amino acids
Gene name: ATG8
Description: Autophagy-related protein 8
Browser: contigC:4483314-4483808-
RNA-seq: read pairs 1454, FPKM 139.3, percentile rank 84.0% (100% = highest expression)
Protein function
| Annotation: | ATG8 | Autophagy-related protein 8 | |
|---|---|---|---|
| KEGG: | K08341 | GABARAP | GABA(A) receptor-associated protein |
| EGGNOG: | 0PNV6 | ATG8 | Involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. May mediate the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton (By similarity) |
| SGD closest match: | S000000174 | ATG8 | Autophagy-related protein 8 |
| CGD closest match: | CAL0000182486 | ATG8 | Autophagy-related protein 8 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04397_1 | 91.80% | 122 | 1e-79 | MIA_04397_1 |
| A0A060TA35_BLAAD | 85.34% | 116 | 1e-71 | Autophagy-related protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C41976g PE=3 SV=1 |
| A0A1E3PS18_9ASCO | 83.62% | 116 | 2e-70 | Autophagy-related protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_20327 PE=3 SV=1 |
| A0A0J9X4Y0_GEOCN | 83.19% | 119 | 4e-70 | Autophagy-related protein OS=Geotrichum candidum GN=BN980_GECA02s01319g PE=3 SV=1 |
| ATG8_YARLI | 80.51% | 118 | 4e-69 | Autophagy-related protein 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG8 PE=3 SV=2 |
| UniRef50_Q2UBH5 | 82.20% | 118 | 6e-65 | Autophagy-related protein 8 n=39 Tax=Eukaryota TaxID=2759 RepID=ATG8_ASPOR |
| ATG8_CANAL | 77.78% | 117 | 3e-65 | Autophagy-related protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG8 PE=2 SV=1 |
| ATG8_YEAST | 77.78% | 117 | 3e-64 | Autophagy-related protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG8 PE=1 SV=1 |
| A0A1E4THE0_9ASCO | 70.97% | 124 | 7e-63 | Autophagy-related protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_25107 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0750
Protein family membership
- Autophagy protein Atg8 ubiquitin-like (IPR004241)
Domains and repeats
-
Domain
1
20
40
60
80
100
128
Detailed signature matches
-
-
SSF54236 (Ubiquitin...)
-
no IPR
Unintegrated signatures
Residue annotation
-
predicted tubulin ...
-
predicted ATG7 bin...
Protein sequence
>MCA_04941_1 MRSQFKEEHSFETRKAEAERIRHKYNDRIPVICEKVEKSDIPPIDKRKYLVPSDLTVGQFLYVIRKRISLSAEKAVFIFV NDVLPPTAALMSTIYQEHKDPDGFLYITYSGENTFGKIIFDNLFDDDM
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.