Protein

MIA_04370_1

Length
195 amino acids


Browser: contig05:1525592-1526352+

Protein function

EGGNOG:0PHXKPRE1The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)
SGD closest match:S000000814PRE1Proteasome subunit beta type-4
CGD closest match:CAL0000196012PRE1Proteasome core particle subunit beta 4

Protein alignments

%idAln lengthE-value
MCA_00942_179.487%1958.83e-122MCA_00942_1
A0A0J9XFP4_GEOCN73.333%1953.31e-109Similar to Saccharomyces cerevisiae YER012W PRE1 Beta 4 subunit of the 20S proteasome OS=Geotrichum candidum GN=BN980_GECA13s03112g PE=4 SV=1
A0A167D5W4_9ASCO65.263%1901.32e-98Proteasome core particle subunit beta 4 OS=Sugiyamaella lignohabitans GN=PRE1 PE=4 SV=1
A0A1E3PJZ5_9ASCO63.590%1954.55e-94Proteasome component C11 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46398 PE=4 SV=1
A0A060TB60_BLAAD61.538%1953.92e-93ARAD1D32384p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D32384g PE=4 SV=1
PSB4_YEAST59.487%1952.04e-91Proteasome subunit beta type-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE1 PE=1 SV=2
UniRef50_P2214159.487%1954.89e-88Proteasome subunit beta type-4 n=348 Tax=Eukaryota TaxID=2759 RepID=PSB4_YEAST
Q5AJZ5_CANAL59.686%1911.11e-87Proteasome core particle subunit beta 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRE1 PE=4 SV=1
A0A1E4TC31_9ASCO56.771%1922.40e-77Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13934 PE=4 SV=1
Q6CF05_YARLI57.895%1905.47e-76YALI0B11374p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B11374g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0291

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 195

Detailed signature matches

    1. PF00227 (Proteasome)
    1. PS51476 (PROTEASOME...)
    1. cd03758 (proteasome...)
    1. SSF56235 (N-termina...)

Protein sequence

>MIA_04370_1
MDVLLGITTGDAVILATSKAAMRGISVLKSDDDKTRDLTTTSSLAFSGEAGDAVQFAEYILANISLYGMRNGYEMSSTAI
ASYLRNEMATSLRSRKPYQVNMLLGSYDVRKEKPSLYWIDYLASAVDLPYAAHGYASYYILSLLDRHHRPGLTLEEGLDL
MKLCVDEIKRRIPLDFKGIQIKIIDKNGVRLSNDL

GO term prediction

Biological Process

GO:0051603 proteolysis involved in cellular protein catabolic process

Molecular Function

GO:0004298 threonine-type endopeptidase activity

Cellular Component

GO:0005839 proteasome core complex