MIA_04353_1

Browser: contig05:1489304-1490157+

Protein function

EGGNOG:	0PNXJ	TIM21	Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Required to keep the TOM and the TIM23 complexes in close contact. At some point, it is released from the TOM23 complex to allow protein translocation into the mitochondrial matrix
SGD closest match:	S000003265	TIM21	Mitochondrial import inner membrane translocase subunit TIM21
CGD closest match:	CAL0000180033	TIM21	Mitochondrial import inner membrane translocase subunit TIM21

Protein alignments

	%id	Aln length	E-value
MCA_04615_1	66.279%	172	1.49e-79	MCA_04615_1
A0A0J9X4R4_GEOCN	56.742%	178	5.02e-67	Similar to Saccharomyces cerevisiae YGR033C TIM21 Nonessential subunit of the Translocase of the Inner Mitochondrial membrane (TIM23 complex) OS=Geotrichum candidum GN=BN980_GECA02s06940g PE=4 SV=1
UniRef50_A0A0J9X4R4	56.742%	178	1.03e-63	Similar to Saccharomyces cerevisiae YGR033C TIM21 Nonessential subunit of the Translocase of the Inner Mitochondrial membrane (TIM23 complex) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X4R4_GEOCN
A0A060T7W4_BLAAD	50.867%	173	2.76e-51	ARAD1C31262p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C31262g PE=4 SV=1
A0A167DBI7_9ASCO	51.744%	172	1.23e-48	Tim21p OS=Sugiyamaella lignohabitans GN=TIM21 PE=4 SV=1
A0A1E3PFM4_9ASCO	41.758%	182	6.07e-40	TIM21-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84351 PE=4 SV=1
A0A1E4TH17_9ASCO	41.481%	135	3.56e-33	Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31812 PE=4 SV=1
TIM21_YARLI	38.194%	144	8.06e-30	Mitochondrial import inner membrane translocase subunit TIM21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM21 PE=3 SV=1
TIM21_CANAL	36.517%	178	5.05e-26	Mitochondrial import inner membrane translocase subunit TIM21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM21 PE=3 SV=1
TIM21_YEAST	34.857%	175	3.72e-24	Mitochondrial import inner membrane translocase subunit TIM21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM21 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9995
Predicted cleavage: 79

Protein family membership

Domains and repeats

Detailed signature matches

Protein sequence

>MIA_04353_1
MPATILNTCLLRSSRLLATPCVHRQIGYRSITSTTGYLRPLLAYPRPTTRSFTASTSRRSSSKSSSRGSGIVNGISRAVS
FSFYACLIVGGIGTLGIVGYLFVSEILLPSSDVALYNKTFSIIEKDPVCLEVLGDRIKAHGEEQSNKWARSRPIAANRGF
DKYQREHMWMQFHVQGEKNSGLVRLEMVRDPHGSNTFEYRYLVLEVPGFERIYLIDKTPQPARKTASGLFWGIKWGKKQD

GO term prediction