Protein

MCA_04615_1

Length
241 amino acids


Gene name: TIM21

Description: Mitochondrial import inner membrane translocase subunit TIM21

Browser: contigC:3517458-3518340+

RNA-seq: read pairs 1404, FPKM 71.7, percentile rank 73.2% (100% = highest expression)

Protein function

Annotation:TIM21Mitochondrial import inner membrane translocase subunit TIM21
KEGG:K17796TIM21 mitochondrial import inner membrane translocase subunit TIM21
EGGNOG:0PNXJTIM21Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Required to keep the TOM and the TIM23 complexes in close contact. At some point, it is released from the TOM23 complex to allow protein translocation into the mitochondrial matrix
SGD closest match:S000003265TIM21Mitochondrial import inner membrane translocase subunit TIM21
CGD closest match:CAL0000180033TIM21Mitochondrial import inner membrane translocase subunit TIM21

Protein alignments

%idAln lengthE-value
MIA_04353_166.28%1722e-74MIA_04353_1
A0A0J9X4R4_GEOCN61.41%1845e-65Similar to Saccharomyces cerevisiae YGR033C TIM21 Nonessential subunit of the Translocase of the Inner Mitochondrial membrane (TIM23 complex) OS=Geotrichum candidum GN=BN980_GECA02s06940g PE=4 SV=1
UniRef50_A0A0J9X4R461.41%1849e-62Similar to Saccharomyces cerevisiae YGR033C TIM21 Nonessential subunit of the Translocase of the Inner Mitochondrial membrane (TIM23 complex) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X4R4_GEOCN
A0A060T7W4_BLAAD53.98%1761e-51ARAD1C31262p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C31262g PE=4 SV=1
A0A167DBI7_9ASCO50.83%1812e-46Tim21p OS=Sugiyamaella lignohabitans GN=TIM21 PE=4 SV=1
A0A1E3PFM4_9ASCO42.08%1831e-35TIM21-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84351 PE=4 SV=1
A0A1E4TH17_9ASCO39.42%1373e-31Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31812 PE=4 SV=1
TIM21_YARLI32.33%2328e-25Mitochondrial import inner membrane translocase subunit TIM21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM21 PE=3 SV=1
TIM21_CANAL32.61%1843e-23Mitochondrial import inner membrane translocase subunit TIM21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM21 PE=3 SV=1
TIM21_YEAST35.37%1472e-18Mitochondrial import inner membrane translocase subunit TIM21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM21 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9864
Predicted cleavage: 67

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_04615_1
MRSAIRPVLTIGRFGLLSCRSQPARSIIMSSLLHKSTTLNKAPTIQSKRHYSSANSEGVFSKLSRAVSFSFYSGIVLGGV
GLVGVIIYLFVSELLLPSSDVALFNKTFSIVSKDPECIKLLGDRITAHGEESGNKWARSRPIATERGYDRWGRERLLMQF
HVQGELNKGLVRVEMIKDPNGSNAFDYRYLVLEIPSHPRIYLIDNTPKTAVKKSASNLFWGIKWGPKKEDKNENSSGHDE
K

GO term prediction

Biological Process

GO:0030150 protein import into mitochondrial matrix

Molecular Function

None predicted.

Cellular Component

GO:0005744 mitochondrial inner membrane presequence translocase complex