MCA_04615_1

Gene name: TIM21

Description: Mitochondrial import inner membrane translocase subunit TIM21

Browser: contigC:3517458-3518340+

RNA-seq: read pairs 1404, FPKM 71.7, percentile rank 73.2% (100% = highest expression)

Protein function

Annotation:		TIM21	Mitochondrial import inner membrane translocase subunit TIM21
KEGG:	K17796	TIM21	mitochondrial import inner membrane translocase subunit TIM21
EGGNOG:	0PNXJ	TIM21	Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Required to keep the TOM and the TIM23 complexes in close contact. At some point, it is released from the TOM23 complex to allow protein translocation into the mitochondrial matrix
SGD closest match:	S000003265	TIM21	Mitochondrial import inner membrane translocase subunit TIM21
CGD closest match:	CAL0000180033	TIM21	Mitochondrial import inner membrane translocase subunit TIM21

Protein alignments

	%id	Aln length	E-value
MIA_04353_1	66.28%	172	2e-74	MIA_04353_1
A0A0J9X4R4_GEOCN	61.41%	184	5e-65	Similar to Saccharomyces cerevisiae YGR033C TIM21 Nonessential subunit of the Translocase of the Inner Mitochondrial membrane (TIM23 complex) OS=Geotrichum candidum GN=BN980_GECA02s06940g PE=4 SV=1
UniRef50_A0A0J9X4R4	61.41%	184	9e-62	Similar to Saccharomyces cerevisiae YGR033C TIM21 Nonessential subunit of the Translocase of the Inner Mitochondrial membrane (TIM23 complex) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X4R4_GEOCN
A0A060T7W4_BLAAD	53.98%	176	1e-51	ARAD1C31262p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C31262g PE=4 SV=1
A0A167DBI7_9ASCO	50.83%	181	2e-46	Tim21p OS=Sugiyamaella lignohabitans GN=TIM21 PE=4 SV=1
A0A1E3PFM4_9ASCO	42.08%	183	1e-35	TIM21-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84351 PE=4 SV=1
A0A1E4TH17_9ASCO	39.42%	137	3e-31	Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31812 PE=4 SV=1
TIM21_YARLI	32.33%	232	8e-25	Mitochondrial import inner membrane translocase subunit TIM21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIM21 PE=3 SV=1
TIM21_CANAL	32.61%	184	3e-23	Mitochondrial import inner membrane translocase subunit TIM21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM21 PE=3 SV=1
TIM21_YEAST	35.37%	147	2e-18	Mitochondrial import inner membrane translocase subunit TIM21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM21 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9864
Predicted cleavage: 67

Protein family membership

Domains and repeats

Detailed signature matches

Protein sequence

>MCA_04615_1
MRSAIRPVLTIGRFGLLSCRSQPARSIIMSSLLHKSTTLNKAPTIQSKRHYSSANSEGVFSKLSRAVSFSFYSGIVLGGV
GLVGVIIYLFVSELLLPSSDVALFNKTFSIVSKDPECIKLLGDRITAHGEESGNKWARSRPIATERGYDRWGRERLLMQF
HVQGELNKGLVRVEMIKDPNGSNAFDYRYLVLEIPSHPRIYLIDNTPKTAVKKSASNLFWGIKWGPKKEDKNENSSGHDE
K

GO term prediction