Protein

MIA_04331_1

Length
256 amino acids


Browser: contig05:1431850-1432882+

Protein function

EGGNOG:0PIBYCAP1F-actin-capping proteins bind in a Ca(2 )-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments
SGD closest match:S000001490CAP1F-actin-capping protein subunit alpha
CGD closest match:CAL0000176864CAP01F-actin-capping protein subunit alpha

Protein alignments

%idAln lengthE-value
MCA_02964_164.599%2745.40e-133MCA_02964_1
A0A0J9X470_GEOCN62.835%2616.28e-119Similar to Saccharomyces cerevisiae YKL007W CAP1 Alpha subunit of the capping protein heterodimer (Cap1p and Cap2p) OS=Geotrichum candidum GN=BN980_GECA02s07182g PE=3 SV=1
A0A1E3PGJ9_9ASCO49.606%2542.41e-89F-actin capping protein alpha subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52172 PE=3 SV=1
UniRef50_A0A1E3PGJ949.606%2546.55e-86F-actin capping protein alpha subunit n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3PGJ9_9ASCO
CAPZA_YARLI43.023%2587.33e-69F-actin-capping protein subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CAP1 PE=3 SV=2
A0A060T942_BLAAD42.529%2611.51e-64ARAD1C35068p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C35068g PE=3 SV=1
CAPZA_YEAST36.604%2656.64e-51F-actin-capping protein subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAP1 PE=1 SV=1
CAPZA_CANAL31.159%2761.53e-38F-actin-capping protein subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAP01 PE=3 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2682

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PR00191 (FACTINCAPA)
    2. PF01267 (F-actin_cap_A)
    1. PS00749 (F_ACTIN_CA...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF90096 (Subunits ...)

Protein sequence

>MIA_04331_1
MASEFAAKVIADAPPDLEILSQEASGLSRNTNAAVAKYNVDQFTIVTLEGSKKTVLSPFNQAEDLFFDPVLKKQYEYDHL
AKKAINVSSYSTDADVDDLYDSVSRYVAEHFPSSSGFGVFPQPDQTIAIVIVDSKYSPANYWNGRWRSWYLLDPSSGSIS
GSVELDIHYFEDGNVRLTTRKEIGFTVSDATDSPAVVAQIAAHESEYQDELNRSLVGLNEGPFKALRRQLPVTRSKMNWG
SALGNYRLGKDIGGAN

GO term prediction

Biological Process

GO:0051016 barbed-end actin filament capping

Molecular Function

None predicted.

Cellular Component

GO:0008290 F-actin capping protein complex