Protein
MCA_02964_1
Length
274 amino acids
Gene name: CAP1
Description: F-actin-capping protein subunit alpha
Browser: contigB:2919100-2920079-
RNA-seq: read pairs 4865, FPKM 218.6, percentile rank 89.1% (100% = highest expression)
Protein function
Annotation: | CAP1 | F-actin-capping protein subunit alpha | |
---|---|---|---|
KEGG: | K10364 | CAPZA | capping protein (actin filament) muscle Z-line, alpha |
EGGNOG: | 0PIBY | CAP1 | F-actin-capping proteins bind in a Ca(2 )-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments |
SGD closest match: | S000001490 | CAP1 | F-actin-capping protein subunit alpha |
CGD closest match: | CAL0000176864 | CAP01 | F-actin-capping protein subunit alpha |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_04331_1 | 64.60% | 274 | 3e-131 | MIA_04331_1 |
A0A0J9X470_GEOCN | 62.83% | 269 | 2e-125 | Similar to Saccharomyces cerevisiae YKL007W CAP1 Alpha subunit of the capping protein heterodimer (Cap1p and Cap2p) OS=Geotrichum candidum GN=BN980_GECA02s07182g PE=3 SV=1 |
A0A1E3PGJ9_9ASCO | 51.91% | 262 | 6e-93 | F-actin capping protein alpha subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52172 PE=3 SV=1 |
UniRef50_A0A1E3PGJ9 | 51.91% | 262 | 2e-89 | F-actin capping protein alpha subunit n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3PGJ9_9ASCO |
CAPZA_YARLI | 42.26% | 265 | 7e-73 | F-actin-capping protein subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CAP1 PE=3 SV=2 |
A0A060T942_BLAAD | 43.54% | 271 | 5e-69 | ARAD1C35068p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C35068g PE=3 SV=1 |
CAPZA_YEAST | 37.45% | 267 | 2e-54 | F-actin-capping protein subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAP1 PE=1 SV=1 |
CAPZA_CANAL | 32.14% | 280 | 5e-37 | F-actin-capping protein subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAP01 PE=3 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2067
Protein family membership
- F-actin-capping protein subunit alpha (IPR002189)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS00749 (F_ACTIN_CA...)
-

Unintegrated signatures
-
SSF90096 (Subunits ...)
Protein sequence
>MCA_02964_1 MASQFAAQVIADTPPGELTSVIDDLQVISEETPGLVRDLDDQVAKYNIDQFTIVELDGGKKTLITPFNQAEDVFFDPILQ KQFEYDHTSRRVSNISSYSGPNKSIELVTSLHKSLCKYVTEHYPSSYGFGVFPQPDNTIAVVIVDSKYSPSNFWNGRWRS WYLFDPSSGRVSGSIELDIHYFEDGNVRMKTRKEIGIVTDEQNNNNDEKIAVDLVAKIAAAEAKYQEEVNHSFVGLNEGP FKALRRQLPVTRSKMNWGKAMGNYRLGKDIGGAH
GO term prediction
Biological Process
GO:0051016 barbed-end actin filament capping
Molecular Function
None predicted.
Cellular Component
GO:0008290 F-actin capping protein complex