Protein

MIA_04313_1

Length
154 amino acids


Browser: contig05:1396338-1396803-

Protein function

EGGNOG:0PJTITIM17Mitochondrial import inner membrane translocase subunit
SGD closest match:S000003679TIM17Mitochondrial import inner membrane translocase subunit TIM17
CGD closest match:CAL0000179179TIM17Mitochondrial import inner membrane translocase subunit TIM17

Protein alignments

%idAln lengthE-value
MCA_01885_186.364%1545.18e-95MCA_01885_1
A0A0J9XK16_GEOCN84.211%1522.95e-92Mitochondrial import inner membrane translocase subunit TIM17 OS=Geotrichum candidum GN=BN980_GECA27s00835g PE=3 SV=1
A0A060T457_BLAAD83.444%1513.80e-91Mitochondrial import inner membrane translocase subunit TIM17 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C41646g PE=3 SV=1
A0A161HFI3_9ASCO80.263%1522.00e-89Mitochondrial import inner membrane translocase subunit TIM17 OS=Sugiyamaella lignohabitans GN=TIM17 PE=3 SV=1
A0A1E3PLJ6_9ASCO77.778%1537.21e-87Mitochondrial import inner membrane translocase subunit TIM17 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51425 PE=3 SV=1
UniRef50_J6EJ2876.351%1482.21e-80Mitochondrial import inner membrane translocase subunit TIM17 n=14 Tax=saccharomyceta TaxID=716545 RepID=J6EJ28_SACK1
A0A1E4TIG0_9ASCO77.027%1481.58e-83Mitochondrial import inner membrane translocase subunit TIM17 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_84 PE=3 SV=1
TIM17_YEAST76.351%1489.25e-83Mitochondrial import inner membrane translocase subunit TIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM17 PE=1 SV=1
Q59LI2_CANAL77.181%1497.55e-82Mitochondrial import inner membrane translocase subunit TIM17 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM17 PE=3 SV=1
B5FVH9_YARLI75.188%1331.02e-72YALI0E15136p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E15136g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0520

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_04313_1
MADTTRDPCPIVILNDFGGAFSMGVLGGAVWHAIKGFRNSPYGERRAGAISAIKLRAPTVGGNFGVWGGIFSTFDCAVKA
VRRTEDPFNAIIAGFFTGGALAIRGGWKATRNGAITCACVLAVFEGVGIAFQRIMAPQAMPMAPEIPDAALPAA

GO term prediction

Biological Process

GO:0006886 intracellular protein transport

Molecular Function

GO:0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity

Cellular Component

GO:0005744 mitochondrial inner membrane presequence translocase complex