Protein

MCA_01885_1

Length
154 amino acids

Gene name: TIM17

Description: Mitochondrial import inner membrane translocase subunit TIM17

Browser: contigA:5773967-5774610+

RNA-seq: read pairs 1374, FPKM 109.5, percentile rank 80.3% (100% = highest expression)

Protein function

Annotation:TIM17Mitochondrial import inner membrane translocase subunit TIM17
KEGG:K17795TIM17 mitochondrial import inner membrane translocase subunit TIM17
EGGNOG:0PJTITIM17Mitochondrial import inner membrane translocase subunit
SGD closest match:S000003679TIM17Mitochondrial import inner membrane translocase subunit TIM17
CGD closest match:CAL0000179179TIM17Mitochondrial import inner membrane translocase subunit TIM17

Protein alignments

%idAln lengthE-value
A0A060T457_BLAAD88.08%1518e-98Mitochondrial import inner membrane translocase subunit TIM17 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C41646g PE=3 SV=1
MIA_04313_186.36%1542e-93MIA_04313_1
A0A0J9XK16_GEOCN84.21%1529e-94Mitochondrial import inner membrane translocase subunit TIM17 OS=Geotrichum candidum GN=BN980_GECA27s00835g PE=3 SV=1
A0A161HFI3_9ASCO83.78%1486e-92Mitochondrial import inner membrane translocase subunit TIM17 OS=Sugiyamaella lignohabitans GN=TIM17 PE=3 SV=1
A0A1E3PLJ6_9ASCO81.05%1533e-90Mitochondrial import inner membrane translocase subunit TIM17 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51425 PE=3 SV=1
A0A1E4TIG0_9ASCO79.73%1482e-86Mitochondrial import inner membrane translocase subunit TIM17 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_84 PE=3 SV=1
UniRef50_Q75BM376.51%1492e-79Mitochondrial import inner membrane translocase subunit TIM17 n=6 Tax=Opisthokonta TaxID=33154 RepID=Q75BM3_ASHGO
TIM17_YEAST74.50%1491e-81Mitochondrial import inner membrane translocase subunit TIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIM17 PE=1 SV=1
Q59LI2_CANAL73.20%1531e-78Mitochondrial import inner membrane translocase subunit TIM17 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIM17 PE=3 SV=1
B5FVH9_YARLI74.44%1337e-71YALI0E15136p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E15136g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0447

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR003397
    Mitochondrial inner membrane translocase subunit Tim17/Tim22/Tim23/peroxisomal protein PMP24
    1. PF02466 (Tim17)
  2. Family IPR005678
    Mitochondrial inner membrane translocase complex, subunit Tim17
    1. TIGR00980
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. TMhelix
  4. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_01885_1
MADHSRDPCPIVILSDFGGAFSMGVVGGAIWHGIKGFRNSPIGERRAGAISAIKLRAPTVGGNFGVWGGIFSTFDCLVKS
VRRTEDPFNAIIAGFFTGGALAIRGGWKATRNGAIACACVLAVFEGVGLGMQRMMAYQNKPVAPQIPDAPLAAA

GO term prediction

Biological Process

GO:0006886 intracellular protein transport

Molecular Function

GO:0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity

Cellular Component

GO:0005744 mitochondrial inner membrane presequence translocase complex