Protein
MIA_04287_1
Length
208 amino acids
Browser: contig05:1317416-1318043-
Protein function
| EGGNOG: | 0PQMB | GET1 | Required for the post-translational delivery of tail- anchored (TA) proteins to the endoplasmic reticulum. Acts as a membrane receptor for soluble get3, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol (By similarity) |
|---|---|---|---|
| CGD closest match: | CAL0000180884 | GET1 | Golgi to ER traffic protein 1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A1E3PJR1_9ASCO | 55.629% | 151 | 4.08e-43 | Golgi to ER traffic protein 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=GET1 PE=3 SV=1 |
| UniRef50_A0A1E3PJR1 | 55.629% | 151 | 1.11e-39 | Golgi to ER traffic protein 1 n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PJR1_9ASCO |
| A0A0J9XJM5_GEOCN | 52.273% | 176 | 1.61e-42 | Golgi to ER traffic protein 1 OS=Geotrichum candidum GN=GET1 PE=3 SV=1 |
| MCA_05441_1 | 47.802% | 182 | 7.21e-41 | MCA_05441_1 |
| A0A060TDH4_BLAAD | 45.455% | 176 | 7.84e-39 | Golgi to ER traffic protein 1 OS=Blastobotrys adeninivorans GN=GET1 PE=3 SV=1 |
| GET1_YARLI | 44.304% | 158 | 1.38e-32 | Golgi to ER traffic protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GET1 PE=3 SV=1 |
| GET1_CANAL | 33.540% | 161 | 7.61e-21 | Golgi to ER traffic protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GET1 PE=3 SV=1 |
| A0A1E4TFL6_9ASCO | 39.823% | 113 | 3.44e-11 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_107019 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1165
Predicted cleavage: 26
Protein family membership
- WRB/Get1 family (IPR028945)
- Get 1, fungi (IPR027538)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
NON_CYTOPLASM... (N...)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_04287_1 MIPLLVLVLLVVVFSRAISIIGKDTICDVLWSLYLRIAPPSPTLRTLRAKQARARQVHAERAATSAKDEFARWAKLDREA GKLRTEIDLLQSSLVSSKTSFNGVLKVTLFALTTGAKLGLRFWYRKTPVFWVPPGVWPGYVYWFLAFSSAPRGSVSVSSW LFVVDWSVSLIEYLVTGTYKEFIASKDSSATSTEAEPKPSKKIEEIKN
GO term prediction
Biological Process
GO:0071816 tail-anchored membrane protein insertion into ER membrane
Molecular Function
None predicted.
Cellular Component
GO:0043529 GET complex