Protein

MCA_05441_1

Length
206 amino acids


Gene name: GET1

Description: Golgi to ER traffic protein 1

Browser: contigD:1336243-1336864+

RNA-seq: read pairs 1524, FPKM 91.0, percentile rank 77.2% (100% = highest expression)

Protein function

Annotation:GET1Golgi to ER traffic protein 1
EGGNOG:0PQMBGET1Required for the post-translational delivery of tail- anchored (TA) proteins to the endoplasmic reticulum. Acts as a membrane receptor for soluble get3, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol (By similarity)
SGD closest match:S000002988GET1Golgi to ER traffic protein 1
CGD closest match:CAL0000180884GET1Golgi to ER traffic protein 1

Protein alignments

%idAln lengthE-value
A0A060TDH4_BLAAD44.78%2012e-58Golgi to ER traffic protein 1 OS=Blastobotrys adeninivorans GN=GET1 PE=3 SV=1
UniRef50_A0A060TDH444.78%2014e-55Golgi to ER traffic protein 1 n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060TDH4_BLAAD
MIA_04287_147.85%1863e-55MIA_04287_1
A0A1E3PJR1_9ASCO44.51%1732e-48Golgi to ER traffic protein 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=GET1 PE=3 SV=1
A0A0J9XJM5_GEOCN46.20%1713e-42Golgi to ER traffic protein 1 OS=Geotrichum candidum GN=GET1 PE=3 SV=1
GET1_YARLI43.21%1629e-40Golgi to ER traffic protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GET1 PE=3 SV=1
GET1_CANAL31.21%1733e-27Golgi to ER traffic protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GET1 PE=3 SV=1
A0A1E4TFL6_9ASCO39.39%1329e-23Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_107019 PE=4 SV=1
GET1_YEAST26.21%2063e-07Golgi to ER traffic protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GET1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1965

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF04420 (CHD5)
    1. MF_03113 (Get1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_05441_1
MLSLLLAIIFIIVFSKVLNYIGKDNISEFLWAFYTRYLTFDPTVSKLTQLQSQAVKVYKARSNTSAKDEFARWAKLDREY
GKLKTEIDKLTAALQTRKTSFKSVVKMALFALSGGSKMFVRLWYRKTPVFWLPPNIFPSYVLWILSFGVPTGAVSVTAWM
WAVEKFLAALESIVKEAIFEYKHMSELSSSANPTPIAVTTKEKSDL

GO term prediction

Biological Process

GO:0071816 tail-anchored membrane protein insertion into ER membrane

Molecular Function

None predicted.

Cellular Component

GO:0043529 GET complex