Protein
MCA_05441_1
Length
206 amino acids
Gene name: GET1
Description: Golgi to ER traffic protein 1
Browser: contigD:1336243-1336864+
RNA-seq: read pairs 1524, FPKM 91.0, percentile rank 77.2% (100% = highest expression)
Protein function
Annotation: | GET1 | Golgi to ER traffic protein 1 | |
---|---|---|---|
EGGNOG: | 0PQMB | GET1 | Required for the post-translational delivery of tail- anchored (TA) proteins to the endoplasmic reticulum. Acts as a membrane receptor for soluble get3, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol (By similarity) |
SGD closest match: | S000002988 | GET1 | Golgi to ER traffic protein 1 |
CGD closest match: | CAL0000180884 | GET1 | Golgi to ER traffic protein 1 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A060TDH4_BLAAD | 44.78% | 201 | 2e-58 | Golgi to ER traffic protein 1 OS=Blastobotrys adeninivorans GN=GET1 PE=3 SV=1 |
UniRef50_A0A060TDH4 | 44.78% | 201 | 4e-55 | Golgi to ER traffic protein 1 n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060TDH4_BLAAD |
MIA_04287_1 | 47.85% | 186 | 3e-55 | MIA_04287_1 |
A0A1E3PJR1_9ASCO | 44.51% | 173 | 2e-48 | Golgi to ER traffic protein 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=GET1 PE=3 SV=1 |
A0A0J9XJM5_GEOCN | 46.20% | 171 | 3e-42 | Golgi to ER traffic protein 1 OS=Geotrichum candidum GN=GET1 PE=3 SV=1 |
GET1_YARLI | 43.21% | 162 | 9e-40 | Golgi to ER traffic protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GET1 PE=3 SV=1 |
GET1_CANAL | 31.21% | 173 | 3e-27 | Golgi to ER traffic protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GET1 PE=3 SV=1 |
A0A1E4TFL6_9ASCO | 39.39% | 132 | 9e-23 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_107019 PE=4 SV=1 |
GET1_YEAST | 26.21% | 206 | 3e-07 | Golgi to ER traffic protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GET1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1965
Protein family membership
- WRB/Get1 family (IPR028945)
- Get 1, fungi (IPR027538)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_05441_1 MLSLLLAIIFIIVFSKVLNYIGKDNISEFLWAFYTRYLTFDPTVSKLTQLQSQAVKVYKARSNTSAKDEFARWAKLDREY GKLKTEIDKLTAALQTRKTSFKSVVKMALFALSGGSKMFVRLWYRKTPVFWLPPNIFPSYVLWILSFGVPTGAVSVTAWM WAVEKFLAALESIVKEAIFEYKHMSELSSSANPTPIAVTTKEKSDL
GO term prediction
Biological Process
GO:0071816 tail-anchored membrane protein insertion into ER membrane
Molecular Function
None predicted.
Cellular Component
GO:0043529 GET complex