Protein

MIA_04285_1

Length
445 amino acids


Browser: contig05:1307065-1308403-

Protein function

EGGNOG:0PNNTNCS2Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). May act by forming a heterodimer with NCS6 that ligates sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position. Prior mcm(5) tRNA modification by the elongator complex is required for 2-thiolation. May also be involved in protein urmylation (By similarity)
SGD closest match:S000005063NCS2Cytoplasmic tRNA 2-thiolation protein 2
CGD closest match:CAL0000189560NCS2Cytoplasmic tRNA 2-thiolation protein 2

Protein alignments

%idAln lengthE-value
MCA_05639_133.272%5413.12e-80MCA_05639_1
A0A167FGG3_9ASCO27.312%4655.36e-37Cytoplasmic tRNA 2-thiolation protein 2 OS=Sugiyamaella lignohabitans GN=NCS2 PE=3 SV=1
UniRef50_A0A167FGG327.312%4651.47e-33Cytoplasmic tRNA 2-thiolation protein 2 n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A167FGG3_9ASCO
A0A060T5X9_BLAAD26.667%4353.82e-27Cytoplasmic tRNA 2-thiolation protein 2 OS=Blastobotrys adeninivorans GN=NCS2 PE=3 SV=1
A0A1E3PDG6_9ASCO24.165%5095.78e-26Cytoplasmic tRNA 2-thiolation protein 2 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NCS2 PE=3 SV=1
A0A0J9XH07_GEOCN40.397%1514.80e-21Cytoplasmic tRNA 2-thiolation protein 2 OS=Geotrichum candidum GN=NCS2 PE=3 SV=1
CTU2_CANAL24.390%4511.17e-18Cytoplasmic tRNA 2-thiolation protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NCS2 PE=3 SV=2
CTU2_YARLI20.582%4813.73e-17Cytoplasmic tRNA 2-thiolation protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NCS2 PE=3 SV=1
CTU2_YEAST19.619%5256.36e-17Cytoplasmic tRNA 2-thiolation protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCS2 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4600
Predicted cleavage: 50

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. MF_03054 (CTU2)
    2. PF10288 (CTU2)

Protein sequence

>MIA_04285_1
MAPSKSATLGDPCSRCRPPTVSPSTALARSEPFCTKCFARFLSTKLRKQIPDYKVAYTRDKKVIPTRHHAVVPVFYSGAP
SSNAAQSPVARDWVWQDSVETAAAIVLIDLLAELIREQRQKHANNQGFVLHIVVVQPSTTPEALCSLVQLLQQLYGHETE
SIDQLGLDTLAGTVLDALPSRASRADALGLIARRALAQYMNKLTTDHSADNWIVAELAADPVEGVAQRILASVAKGRMNL
VYHDLVDLPTASSRIIWPMKEIRTQEVSTYLDLLFASPDKSTILSLLDSSSSQSTTQQQGPAKSLSIDALLRSYFAEIES
AFPSVATTVVRTVEKLADPSTCSPQILQKLSSSPSSVPQYGSCTVCGCAREAKVGEWIKKITVNEGVQEDEITPVESPET
INTSLPAGPLCYGCMVMLKDSSVSTLPDWSTPRSQLSSVLSEYEL

GO term prediction

Biological Process

GO:0002098 tRNA wobble uridine modification
GO:0034227 tRNA thio-modification

Molecular Function

GO:0000049 tRNA binding

Cellular Component

None predicted.