Protein
MCA_05639_1
Length
531 amino acids
Gene name: NCS2
Description: Cytoplasmic tRNA 2-thiolation protein 2
Browser: contigD:1893363-1894959+
RNA-seq: read pairs 653, FPKM 15.2, percentile rank 34.4% (100% = highest expression)
Protein function
| Annotation: | NCS2 | Cytoplasmic tRNA 2-thiolation protein 2 | |
|---|---|---|---|
| KEGG: | K14169 | CTU2 | cytoplasmic tRNA 2-thiolation protein 2 |
| EGGNOG: | 0PNNT | NCS2 | Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). May act by forming a heterodimer with NCS6 that ligates sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position. Prior mcm(5) tRNA modification by the elongator complex is required for 2-thiolation. May also be involved in protein urmylation (By similarity) |
| SGD closest match: | S000005063 | NCS2 | Cytoplasmic tRNA 2-thiolation protein 2 |
| CGD closest match: | CAL0000189560 | NCS2 | Cytoplasmic tRNA 2-thiolation protein 2 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04285_1 | 33.76% | 542 | 1e-81 | MIA_04285_1 |
| A0A0J9XH07_GEOCN | 25.17% | 592 | 2e-28 | Cytoplasmic tRNA 2-thiolation protein 2 OS=Geotrichum candidum GN=NCS2 PE=3 SV=1 |
| A0A1E3PDG6_9ASCO | 26.48% | 506 | 1e-28 | Cytoplasmic tRNA 2-thiolation protein 2 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NCS2 PE=3 SV=1 |
| A0A060T5X9_BLAAD | 24.14% | 464 | 5e-29 | Cytoplasmic tRNA 2-thiolation protein 2 OS=Blastobotrys adeninivorans GN=NCS2 PE=3 SV=1 |
| UniRef50_A0A060T5X9 | 24.14% | 464 | 1e-25 | Cytoplasmic tRNA 2-thiolation protein 2 n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060T5X9_BLAAD |
| A0A167FGG3_9ASCO | 24.64% | 483 | 1e-27 | Cytoplasmic tRNA 2-thiolation protein 2 OS=Sugiyamaella lignohabitans GN=NCS2 PE=3 SV=1 |
| CTU2_YARLI | 22.33% | 506 | 5e-23 | Cytoplasmic tRNA 2-thiolation protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NCS2 PE=3 SV=1 |
| CTU2_YEAST | 23.21% | 530 | 8e-15 | Cytoplasmic tRNA 2-thiolation protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCS2 PE=1 SV=1 |
| CTU2_CANAL | 22.49% | 489 | 1e-11 | Cytoplasmic tRNA 2-thiolation protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NCS2 PE=3 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6186
Predicted cleavage: 27
Protein family membership
- Cytoplasmic tRNA 2-thiolation protein 2 (IPR019407)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_05639_1 MAPRKNLKVGDKCSRCASASILISRDETFCHPCFLRFLSTKLRRQTDNYKVQYNKTKQLIPSRSHVLIPLYDISATNLTS DKEPENPKEGANLALLKESNPWSTQDLLISFSLIHQLVALLQDQRIKHRGNQGFYIHVIHITNSHVREGNSALDLLKAKY PNHEIESYHTLNLLDIENSSLSGELSDLFKYLSALDSKSSKTDALQIYMKYMLVQLAQSLNPVSDDDNGSKWEFSIFVPE TVELVAQRILASISKGRINQIYADFLPVPSFIQPEGQTQNSNNDIGFTWPLKDIKYSEVLQYLQLEWPESLKQYLNDEDK ALLDSLFSTNGAPSQNDKKDGIVAKQMSIDTLIRAYFKDIDESFPSVATTVVRTIEKLVDPVIIQQQQDGIQECTENCTA SECCGSQYNCSLCGCTKSGKELAWISKITVNEGADVSPVEIQSGKFAASTMPKDDETVLKSLCYGCLVMLKDSILVKKVA ESDQSDEDQLSPSPKASKLKIPHWSTSATDSVNNTVSRNNNLKSILAEYEL
GO term prediction
Biological Process
GO:0002098 tRNA wobble uridine modification
GO:0034227 tRNA thio-modification
Molecular Function
GO:0000049 tRNA binding
Cellular Component
None predicted.