Protein

MIA_04282_1

Length
116 amino acids

Browser: contig05:1301145-1301611+

Protein function

EGGNOG:0PQT9COX23Cytochrome c oxidase-assembly factor cox23
SGD closest match:S000001158COX23Cytochrome c oxidase-assembly factor COX23, mitochondrial
CGD closest match:CAL0000183908COX23Cytochrome c oxidase-assembly factor COX23, mitochondrial

Protein alignments

%idAln lengthE-value
MCA_01130_178.261%922.52e-54MCA_01130_1
A0A0J9XHD5_GEOCN69.663%891.90e-45Similar to Saccharomyces cerevisiae YHR116W COX23 Mitochondrial intermembrane space protein that functions in mitochondrial copper homeostasis, essential for functional cytochrome oxidase expression OS=Geotrichum candidum GN=BN980_GECA17s00417g PE=4 SV=1
UniRef50_A0A0J9XHD569.663%893.88e-42Similar to Saccharomyces cerevisiae YHR116W COX23 Mitochondrial intermembrane space protein that functions in mitochondrial copper homeostasis, essential for functional cytochrome oxidase expression n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHD5_GEOCN
A0A1E3PDX4_9ASCO54.639%972.23e-38Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84159 PE=4 SV=1
A0A060T0E5_BLAAD57.317%828.07e-36ARAD1C15840p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C15840g PE=4 SV=1
A0A167DD45_9ASCO60.294%681.35e-27Cox23p OS=Sugiyamaella lignohabitans GN=COX23 PE=4 SV=1
COX23_CANAL47.059%858.48e-26Cytochrome c oxidase-assembly factor COX23, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX23 PE=3 SV=1
COX23_YARLI45.122%822.25e-22Cytochrome c oxidase-assembly factor COX23, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COX23 PE=3 SV=1
COX23_YEAST45.205%732.43e-22Cytochrome c oxidase-assembly factor COX23, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX23 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0178

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 116

Detailed signature matches

  1. Domain IPR009069
    Cysteine alpha-hairpin motif superfamily
    1. SSF47072 (Cysteine ...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.28...
  2. PS51808 (CHCH)
  3. mobidb-lite (disord...)

Protein sequence

>MIA_04282_1
MSEPEKKPETKTEEPAQAKSANLVPQVGIDNSNKATKELKFYPDNPTHYSHKATFTTKEPSQFYDPCQQASQMSMGCLER
NNYDKDACLEYFKAYKECRQEWMDQRKRDRRSGFRW

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.