Protein
MCA_01130_1
Length
124 amino acids
Gene name: COX23
Description: Cytochrome c oxidase-assembly factor COX23, mitochondrial
Browser: contigA:3604117-3604629-
RNA-seq: read pairs 716, FPKM 70.8, percentile rank 72.9% (100% = highest expression)
Protein function
| Annotation: | COX23 | Cytochrome c oxidase-assembly factor COX23, mitochondrial | |
|---|---|---|---|
| KEGG: | K18185 | COX23 | cytochrome c oxidase assembly protein subunit 23 |
| EGGNOG: | 0PQT9 | COX23 | Cytochrome c oxidase-assembly factor cox23 |
| SGD closest match: | S000001158 | COX23 | Cytochrome c oxidase-assembly factor COX23, mitochondrial |
| CGD closest match: | CAL0000183908 | COX23 | Cytochrome c oxidase-assembly factor COX23, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04282_1 | 78.26% | 92 | 6e-53 | MIA_04282_1 |
| A0A0J9XHD5_GEOCN | 73.03% | 89 | 8e-46 | Similar to Saccharomyces cerevisiae YHR116W COX23 Mitochondrial intermembrane space protein that functions in mitochondrial copper homeostasis, essential for functional cytochrome oxidase expression OS=Geotrichum candidum GN=BN980_GECA17s00417g PE=4 SV=1 |
| UniRef50_A0A0J9XHD5 | 73.03% | 89 | 2e-42 | Similar to Saccharomyces cerevisiae YHR116W COX23 Mitochondrial intermembrane space protein that functions in mitochondrial copper homeostasis, essential for functional cytochrome oxidase expression n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHD5_GEOCN |
| A0A1E3PDX4_9ASCO | 49.12% | 114 | 3e-35 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84159 PE=4 SV=1 |
| A0A060T0E5_BLAAD | 59.49% | 79 | 4e-33 | ARAD1C15840p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C15840g PE=4 SV=1 |
| COX23_YARLI | 50.00% | 84 | 1e-25 | Cytochrome c oxidase-assembly factor COX23, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COX23 PE=3 SV=1 |
| A0A167DD45_9ASCO | 60.29% | 68 | 7e-26 | Cox23p OS=Sugiyamaella lignohabitans GN=COX23 PE=4 SV=1 |
| COX23_YEAST | 46.51% | 86 | 1e-24 | Cytochrome c oxidase-assembly factor COX23, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX23 PE=1 SV=1 |
| COX23_CANAL | 48.24% | 85 | 9e-24 | Cytochrome c oxidase-assembly factor COX23, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX23 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0290
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
20
40
60
80
100
124
Detailed signature matches
-
-
SSF47072 (Cysteine ...)
-
no IPR
Unintegrated signatures
-
-
PS51808 (CHCH)
-
mobidb-lite (disord...)
Protein sequence
>MCA_01130_1 MDSSKETNQATEPQQSVPDQASENKAKFEAKEPKVGIDNKNKKIEELKFYPDNPTDFTHKARFSAKGPSQFYDPCSEASK MSMKCLERNNYDKDMCKEYFKAYKECRQEWLDQRKKDRRSGFRW
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.