Protein
MIA_04115_1
Length
78 amino acids
Browser: contig05:804397-804699+
Protein function
| EGGNOG: | 0PTHU | Dolichol phosphate-mannose biosynthesis regulatory protein | |
|---|---|---|---|
| CGD closest match: | CAL0000175581 | DPM2 | Dpm2p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_00120_2 | 84.375% | 64 | 2.77e-24 | MCA_00120_2 |
| A0A0J9X3H9_GEOCN | 73.438% | 64 | 3.29e-24 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA01s09987g PE=4 SV=1 |
| UniRef50_A0A0G2E9S6 | 57.812% | 64 | 1.48e-14 | Dolichol phosphate-mannose biosynthesis regulatory protein n=26 Tax=leotiomyceta TaxID=716546 RepID=A0A0G2E9S6_9PEZI |
| A0A1E4TCQ7_9ASCO | 54.688% | 64 | 1.73e-17 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_139932 PE=4 SV=1 |
| A0A1E3PG63_9ASCO | 51.613% | 62 | 6.36e-17 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83993 PE=4 SV=1 |
| A0A060SYH2_BLAAD | 61.905% | 63 | 8.61e-17 | ARAD1C01210p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C01210g PE=4 SV=1 |
| Q6CFN0_YARLI | 59.375% | 64 | 3.30e-16 | YALI0B05500p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B05500g PE=4 SV=1 |
| A0A1D8PPC1_CANAL | 56.452% | 62 | 6.69e-15 | Dpm2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DPM2 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1061
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_04115_1 MIFVATAVFIYYTTWTFVLPFVDESSPIQSLFLPREWAIRIPVVLLLTAVAGVGTFIGKVLIKNAEKEKRKQAAAKAK
GO term prediction
Biological Process
GO:0019348 dolichol metabolic process
Molecular Function
GO:0030234 enzyme regulator activity
Cellular Component
GO:0030176 integral component of endoplasmic reticulum membrane