Protein
MCA_00120_2
Length
88 amino acids
Browser: contigA:327250-327676-
RNA-seq: read pairs 2277, FPKM 316.1, percentile rank 92.1% (100% = highest expression)
Protein function
KEGG: | K09658 | DPM2 | dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit |
---|---|---|---|
EGGNOG: | 0PTHU | Dolichol phosphate-mannose biosynthesis regulatory protein | |
CGD closest match: | CAL0000175581 | DPM2 | Dpm2p |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9X3H9_GEOCN | 68.18% | 88 | 9e-34 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA01s09987g PE=4 SV=1 |
MIA_04115_1 | 84.85% | 66 | 2e-25 | MIA_04115_1 |
A0A1E4TCQ7_9ASCO | 59.72% | 72 | 2e-22 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_139932 PE=4 SV=1 |
UniRef50_G0S5X0 | 56.16% | 73 | 5e-18 | Putative dolichol phosphate-mannose biosynthesis regulatory protein n=5 Tax=Sordariomycetes TaxID=147550 RepID=G0S5X0_CHATD |
A0A060SYH2_BLAAD | 60.00% | 65 | 1e-17 | ARAD1C01210p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C01210g PE=4 SV=1 |
A0A1D8PPC1_CANAL | 55.56% | 72 | 2e-17 | Dpm2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DPM2 PE=4 SV=1 |
Q6CFN0_YARLI | 56.92% | 65 | 2e-17 | YALI0B05500p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B05500g PE=4 SV=1 |
A0A1E3PG63_9ASCO | 51.61% | 62 | 5e-17 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83993 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0922
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_00120_2 MSFDKLVGAGMIAAATVVFLYYTTWTFVLPFVDELSPIQSLFPPREWAIRIPLVLLLTALLGVGTFIGKVLIKSAEKEKR KKIVAKSK
GO term prediction
Biological Process
GO:0019348 dolichol metabolic process
Molecular Function
GO:0030234 enzyme regulator activity
Cellular Component
GO:0030176 integral component of endoplasmic reticulum membrane