Protein

MIA_04101_1

Length
146 amino acids


Browser: contig05:751941-752502-

Protein function

EGGNOG:0PNPZGRX5Glutaredoxin
SGD closest match:S000005980GRX5Monothiol glutaredoxin-5, mitochondrial
CGD closest match:CAL0000183749orf19.2782Monothiol glutaredoxin

Protein alignments

%idAln lengthE-value
MCA_00056_176.58%1585e-83MCA_00056_1
A0A0J9X5Q6_GEOCN78.62%1458e-82Glutaredoxin OS=Geotrichum candidum GN=BN980_GECA03s02892g PE=3 SV=1
A0A060T5H7_BLAAD71.62%1485e-70Glutaredoxin OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C05544g PE=3 SV=1
UniRef50_C1H9P965.69%1378e-59Glutaredoxin n=63 Tax=Dikarya TaxID=451864 RepID=C1H9P9_PARBA
Q6C0W3_YARLI63.19%1443e-62Glutaredoxin OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F21219g PE=3 SV=1
Q59PW1_CANAL63.16%1523e-61Monothiol glutaredoxin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2782 PE=4 SV=1
A0A1E3PDS9_9ASCO72.41%1161e-59Glutaredoxin (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_6266 PE=4 SV=1
GLRX5_YEAST67.74%1242e-57Monothiol glutaredoxin-5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRX5 PE=1 SV=1
A0A170QY03_9ASCO81.72%936e-55Glutaredoxin OS=Sugiyamaella lignohabitans GN=GRX5 PE=3 SV=1
A0A1E4TH84_9ASCO50.62%812e-24Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2838 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9438
Predicted cleavage: 41

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 146

Detailed signature matches

    1. PIRSF005894 (Monoth...)
    1. SSF52833 (Thioredox...)
    1. PF00462 (Glutaredoxin)
    2. PS51354 (GLUTAREDOX...)
    1. cd03028 (GRX_PICOT_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SFLDG00327 (monothi...)

Residue annotation

  1. putative GSH bindi...
  2. catalytic residues...
  3. SFLDG00327

Protein sequence

>MIA_04101_1
MLARNFMFTSRARLASVAAPRLSMNRFIGLRFLSDETRSAIDRAVASAPVVLFMKGTPEQPMCGFSRNTIQILGYQGVDP
RKFAAYNVLDDSELRQGIKEYSEWPTIPQLYINKEFIGGHDIVVAMNDSGELAELLEKENVLVPEE

GO term prediction

Biological Process

GO:0045454 cell redox homeostasis

Molecular Function

GO:0009055 electron carrier activity
GO:0015035 protein disulfide oxidoreductase activity
GO:0015036 disulfide oxidoreductase activity

Cellular Component

None predicted.