Protein
MIA_04092_1
Length
57 amino acids
Browser: contig05:734948-735264+
Protein function
EGGNOG: | 0PSHB | TOM7 family | |
---|---|---|---|
SGD closest match: | S000005014 | TOM7 | Mitochondrial import receptor subunit TOM7 |
CGD closest match: | CAL0000183702 | TOM7 | Tom7p |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XHA0_GEOCN | 84.211% | 57 | 2.80e-32 | Similar to Saccharomyces cerevisiae YNL070W TOM7 Component of the TOM (Translocase of outer membrane) complex OS=Geotrichum candidum GN=BN980_GECA14s02155g PE=4 SV=1 |
MCA_00035_1 | 80.702% | 57 | 5.35e-31 | MCA_00035_1 |
A0A1E3PGH6_9ASCO | 68.519% | 54 | 3.58e-26 | Tom7-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52173 PE=4 SV=1 |
UniRef50_B2B7F0 | 60.784% | 51 | 7.19e-17 | Podospora anserina S mat+ genomic DNA chromosome 2, supercontig 2 n=7 Tax=leotiomyceta TaxID=716546 RepID=B2B7F0_PODAN |
TOM7_YEAST | 50.000% | 56 | 6.50e-20 | Mitochondrial import receptor subunit TOM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM7 PE=1 SV=2 |
A0A1E4TEV8_9ASCO | 48.148% | 54 | 3.78e-19 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_37012 PE=4 SV=1 |
A0A1D8PQY9_CANAL | 48.077% | 52 | 9.27e-18 | Tom7p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TOM7 PE=4 SV=1 |
B5RSK2_YARLI | 52.632% | 38 | 3.20e-13 | YALI0A16868p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A16868g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2152
Protein family membership
- Mitochondrial import receptor subunit TOM7 (IPR012621)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_04092_1 MPAFTLSDDTKERITRLIEFGRVTVHYGWIPFIIYLGWTQSVPRPGLFKLLSPLPTP
GO term prediction
Biological Process
GO:0030150 protein import into mitochondrial matrix
Molecular Function
None predicted.
Cellular Component
GO:0005742 mitochondrial outer membrane translocase complex