Protein
MCA_00035_1
Length
57 amino acids
Gene name: TOM7
Description: Mitochondrial import receptor subunit TOM7
Browser: contigA:84270-84660-
RNA-seq: read pairs 3754, FPKM 799.7, percentile rank 96.0% (100% = highest expression)
Protein function
| Annotation: | TOM7 | Mitochondrial import receptor subunit TOM7 | |
|---|---|---|---|
| KEGG: | K17771 | TOM7 | mitochondrial import receptor subunit TOM7 |
| EGGNOG: | 0PSHB | TOM7 family | |
| SGD closest match: | S000005014 | TOM7 | Mitochondrial import receptor subunit TOM7 |
| CGD closest match: | CAL0000183702 | TOM7 | Tom7p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04092_1 | 80.70% | 57 | 8e-30 | MIA_04092_1 |
| A0A0J9XHA0_GEOCN | 77.19% | 57 | 8e-29 | Similar to Saccharomyces cerevisiae YNL070W TOM7 Component of the TOM (Translocase of outer membrane) complex OS=Geotrichum candidum GN=BN980_GECA14s02155g PE=4 SV=1 |
| A0A1E3PGH6_9ASCO | 60.78% | 51 | 6e-21 | Tom7-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52173 PE=4 SV=1 |
| UniRef50_B2B7F0 | 62.75% | 51 | 1e-15 | Podospora anserina S mat+ genomic DNA chromosome 2, supercontig 2 n=7 Tax=leotiomyceta TaxID=716546 RepID=B2B7F0_PODAN |
| TOM7_YEAST | 49.06% | 53 | 8e-17 | Mitochondrial import receptor subunit TOM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM7 PE=1 SV=2 |
| A0A1E4TEV8_9ASCO | 49.02% | 51 | 1e-16 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_37012 PE=4 SV=1 |
| A0A1D8PQY9_CANAL | 45.10% | 51 | 5e-15 | Tom7p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TOM7 PE=4 SV=1 |
| B5RSK2_YARLI | 52.63% | 38 | 1e-11 | YALI0A16868p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A16868g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2031
Protein family membership
- Mitochondrial import receptor subunit TOM7 (IPR012621)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MCA_00035_1 MAYFILSDETKERITRLVEFGRVTLQYGWLPFIVYVGWTQSVPRPSLFKLLSPLPTP
GO term prediction
Biological Process
GO:0030150 protein import into mitochondrial matrix
Molecular Function
None predicted.
Cellular Component
GO:0005742 mitochondrial outer membrane translocase complex