Protein

MIA_04082_1

Length
164 amino acids

Browser: contig05:705327-705822+

Protein function

EGGNOG:0PN5PPGUG_01527glutathione peroxidase
SGD closest match:S000001476HYR1Peroxiredoxin HYR1
CGD closest match:CAL0000196844orf19.86Glutathione peroxidase

Protein alignments

%idAln lengthE-value
MCA_00012_181.098%1643.37e-87MCA_00012_1
A0A167DY32_9ASCO75.926%1621.49e-81Glutathione peroxidase OS=Sugiyamaella lignohabitans GN=GPX2 PE=3 SV=1
A0A1E4TKN8_9ASCO80.380%1582.04e-81Glutathione peroxidase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30496 PE=3 SV=1
A0A0J9XK85_GEOCN78.125%1602.98e-81Glutathione peroxidase OS=Geotrichum candidum GN=BN980_GECA21s01484g PE=3 SV=1
GPX3_YEAST76.730%1592.94e-81Peroxiredoxin HYR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HYR1 PE=1 SV=1
UniRef50_P4058176.730%1597.03e-78Peroxiredoxin HYR1 n=266 Tax=cellular organisms TaxID=131567 RepID=GPX3_YEAST
A0A060T2X0_BLAAD74.074%1622.03e-75Glutathione peroxidase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A04114g PE=3 SV=1
A0A1E3PK09_9ASCO70.625%1601.28e-74Glutathione peroxidase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82746 PE=3 SV=1
Q6C7A8_YARLI69.811%1596.08e-73Glutathione peroxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E02310g PE=3 SV=1
Q59WW7_CANAL68.553%1598.06e-73Glutathione peroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.86 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0123

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 164

Detailed signature matches

  1. Family IPR000889
    Glutathione peroxidase
    1. PR01011 (GLUTPROXDASE)
    2. PIRSF000303 (Glutat...)
    3. PS51355 (GLUTATHION...)
    4. cd00340 (GSH_Peroxi...)
    5. PF00255 (GSHPx)
  2. Domain IPR012336
    Thioredoxin-like fold
    1. SSF52833 (Thioredox...)
  3. SITE IPR029759
    Glutathione peroxidase active site
    1. PS00460 (GLUTATHION...)
  4. SITE IPR029760
    Glutathione peroxidase conserved site
    1. PS00763 (GLUTATHION...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.30.10

Residue annotation

  1. catalytic residues...
  2. dimer interface cd...

Protein sequence

>MIA_04082_1
MSVPSSFYDLKPADKTGSPYDFSQLKGKVVLIVNVASKCGFTPQYKELEDVYKKYSPEGLVILGFPCNQFGHQEPGTDDE
ITQFCQLNYGVTFPVLKKIDVNGSNADPVYEFLKSKKSGLLGFKGIKWNFEKFLVDKNGQVVERYSSITKPSSLAPEIEK
LLKA

GO term prediction

Biological Process

GO:0006979 response to oxidative stress
GO:0055114 oxidation-reduction process

Molecular Function

GO:0004602 glutathione peroxidase activity

Cellular Component

None predicted.